KEGG   Chlamydia pecorum E58: G5S_0173Help
Entry
G5S_0173          CDS       T01466                                 

Gene name
cadA
Definition
(GenBank) cadmium-translocating P-type ATPase
  KO
K01534  
Cd2+/Zn2+-exporting ATPase [EC:3.6.3.3 3.6.3.5]
Organism
cpm  Chlamydia pecorum E58
Brite
Enzymes [BR:cpm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.3  Cd2+-exporting ATPase
     G5S_0173 (cadA)
    3.6.3.5  Zn2+-exporting ATPase
     G5S_0173 (cadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
177731..179617
Genome map
AA seq 628 aa AA seqDB search
MLSAESRKLSRNLTLKSSYVSLVTYMVALLCYWFHAENVSHLFTVLTFFFAGTPALIKSL
ENIYHKTINIDILMTSAAFGSIFIGGALEGALLLVLFAISEALGQMVSGKAKSSLASLKQ
LAPTTGWVLLENGHLQQKPIDKICVGDILRIKSGEVVPLDGEIIHGSSSVNLMHLTGEKV
PKSCQIGSIIPAGAHNLEGSFDLRVLRIGADSTIAHIINLVIQAQNSKPALQQRLDKYSS
AYAIAIFAIASAIAIFVPLFSSIPFLGPNSAFYRALAFLIAASPCALIIAIPIAYLSAIN
ACAKHGVLLKGGVILDRLVSCNSIVMDKTGTLTTGTLTCIRCDIFGEKTPEFFPSILALE
QSSSHPIAQAIVKYLAAQRITPRAADRYLTVPGEGVRGFFQDQEAFVGKTETALRTIPRV
YAEDLKQRIFRAKLRGEICSLAYLGSCCALFYFKDEPRPHASEIISELKRLGYPVSILTG
DHKVSAENIAKIVGISEVFANLSPEAKLNKVRELAKRRHILMVGDGINDAPALAQATVGV
AMGEAGSATAIEAADVVLLHDSLASLPWVLKKARQTKKIVSQNLSLALAIILLVSWPASF
GIIPLWLAVILHEGSTVIVGMNALRLLK
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgctttctgctgaaagtcgtaaacttagccgcaatcttactttaaaatcttcctatgta
tccttagtaacttacatggttgcgttattatgctattggtttcacgctgagaatgtctcg
catttatttactgtgttgacgttcttttttgctggtacgcctgcattgattaagtctttg
gaaaacatctatcataaaactataaatattgacattttgatgacgtcagcagcatttggc
tctatctttattggtggagctttagaaggagccttgcttctggtgttgtttgcaatttct
gaagctttagggcagatggtttcagggaaagcaaagagctctttagcatcattaaagcag
cttgcccccacaacaggatgggtactgttagaaaatggtcatcttcagcaaaagccaata
gataaaatctgtgtaggagatattctccgaatcaaaagtggagaagtcgtccctttagat
ggagagatcatccatggttcctcatctgtaaatcttatgcaccttacgggagaaaaggtc
cccaagtcatgccagataggttcgatcattcctgctggagcgcataatcttgaggggagc
tttgaccttagggttttacgtatcggtgcggactccacaattgcacatattattaattta
gtcatccaagcgcaaaactctaagcctgccttgcaacaacgcttagacaaatactcctct
gcctacgccattgccattttcgctattgccagtgccattgccatttttgtgccattattt
tcttctatcccctttttaggcccaaatagcgctttttatcgcgcgttagcctttctcatt
gcagcatccccttgtgctcttatcattgccatccccattgcatatttaagtgccataaat
gcttgtgcgaagcatggtgtgttgttaaaaggcggtgtgattcttgatcgcctagtatcg
tgtaactccatagtgatggataaaacagggacactaactactggcacgctcacctgtatc
cgctgtgatatctttggagaaaaaacccctgaatttttcccttcgattttagctttagag
caatcttcatcgcaccctatagctcaagcaattgtgaaataccttgctgcacagcgcatc
actccgcgtgctgcagatcgctatcttacagtccctggggaaggggtccgaggtttcttc
caagatcaggaagctttcgtagggaaaacagaaacagctctacgaaccattcctagggtc
tatgctgaggatctcaaacagcgcatattccgagctaaacttcgcggggaaatttgctcc
ctagcatatttaggttcgtgttgtgcattattttactttaaagatgagcctcgccctcat
gcttcggagattatttcggaactaaagagattaggctatcccgtaagcatacttacagga
gatcataaagtcagcgcagaaaatatcgccaagatcgttggaatttctgaggtatttgca
aacctctctccagaagcaaagttaaataaagttcgtgagttagcgaagcggcggcatatt
ttgatggtaggagatgggattaatgacgctcctgcgctagctcaggctacggtaggagtc
gctatgggagaagcaggaagtgctacagctatagaagctgcggacgttgtgcttttgcat
gactctttagcttccctaccatgggtgctaaaaaaagctcggcaaacaaaaaaaatcgtt
tctcagaatttaagtttagctctggcaattatcttactagtatcttggcctgcctctttt
ggaatcatccctctatggcttgcggtgattcttcatgagggcagtacggtgattgtcggg
atgaatgctttgcgtttactaaaatag

DBGET integrated database retrieval system