KEGG   Chlamydia pecorum E58: G5S_0174Help
Entry
G5S_0174          CDS       T01466                                 

Gene name
rod
Definition
(GenBank) rod shape protein
  KO
K05837  rod shape determining protein RodA
Organism
cpm  Chlamydia pecorum E58
Brite
Chromosome and associated proteins [BR:cpm03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    G5S_0174 (rod)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTSW_RODA_SPOVE
Motif
Other DBs
NCBI-ProteinID: AEB41192
Position
complement(179619..180758)
Genome map
AA seq 379 aa AA seqDB search
MRHYNYLRHVNLWLFAIMFSLMALSIVVISSMDSLSTLESPSKFPLSAKSLMQLKHFTLG
WIVFVICMHMDYHKLQKWAWLLYLLMLLSLVGLFFVPAVQHVHRWYRIPLIRLSVQPSEY
AKLVVVIMLSYALDARKAQISSKTTAFVACIIVAVPFFLILKEPDLGTALVLCPVALAIL
YLGNIYPPFVRFCAIIAGCGVLCSLLIFSGIISHEKIRPYALKVIKEYQYDRLSPANHHQ
RASLISIGLGGLKGRGWKSGEFAGRGWLPYSYTDSVFPALGEEFGLWGLAVVLLLFYSLI
CFGCRTVAVAVDDFGKLLAGGITVYLSMHILINISMMCGLLPITGVPLVLISYGGSSVIS
SMASLGILQSIYSRRFIRY
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgagacactacaactatcttcgccatgtgaatttatggttgtttgccatcatgttttct
ttaatggctttgagtattgtcgtgatctcttctatggattccctatctacattagagtct
ccatccaagtttcccttgtcagcaaaaagcctcatgcagttgaaacactttactctgggc
tggatcgtctttgttatatgcatgcatatggattaccataaattgcagaagtgggcatgg
ctactctaccttctcatgttgctaagtttagtagggctgttctttgtcccagcagtgcag
catgtgcatagatggtatcggatccccctcatacgccttagtgtacagccttcagaatat
gctaagctcgtggttgtgattatgctaagctatgccttagatgctcgtaaagcacagatc
tcctcaaaaactacagcgttcgttgcatgtatcatcgtcgctgttcctttcttcttgatt
ttgaaagagccagatctaggaaccgcattagtattgtgccctgttgctttggcaatcctt
tacttaggaaacatctacccgccttttgtaagattttgtgcgataattgcaggatgtggt
gtgttatgttctctgctgattttctctgggatcatctcgcatgaaaagatccgtccctat
gctttgaaggtaatcaaagaataccaatatgaccgcctgagccccgctaaccaccatcaa
agagcctcattgatttccatagggttgggaggattaaaaggacgcggatggaagtccgga
gagtttgcagggagaggatggcttccctatagttatacggattccgtatttccagctctg
ggggaggagtttggcctatggggacttgccgtagtgctcctgcttttctactctttgatt
tgctttggttgccgcaccgtagctgtagctgtggatgacttcgggaaactccttgcagga
ggcattacggtgtatctttccatgcatatattaataaatatcagtatgatgtgtggactg
ctgcctatcacgggagttcctctggtcttaatttcttacggaggctcctctgtgatctcc
tctatggcttctttggggattctacaaagtatttatagccgaaggtttatccgttactaa

DBGET integrated database retrieval system