KEGG   Chlamydia pecorum E58: G5S_0177Help
Entry
G5S_0177          CDS       T01466                                 

Definition
(GenBank) RNA pseudouridylate synthase
  KO
K06178  23S rRNA pseudouridine2605 synthase [EC:5.4.99.22]
Organism
cpm  Chlamydia pecorum E58
Brite
Enzymes [BR:cpm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.22  23S rRNA pseudouridine2605 synthase
     G5S_0177
Ribosome biogenesis [BR:cpm03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    G5S_0177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: AEB41195
Position
complement(181880..182584)
Genome map
AA seq 234 aa AA seqDB search
MTKVRLNKFLSAAGIASRRKCDEIIFAGEVTINGRVAQGPFVQVDDQHDRVLVRGKPIAS
TKKVYFMVHKPLGFVCTSERKFPGTKLVIDLFSHLPYRVFTVGRLDKETSGLILVTNDGD
FANKIIHPSYGITKEYLLKVNRDVIEKDLNSLMQGTMIDGKRVRPVAVSKVRRGTIKIVV
NEGKKHEIRLFAEAAGLQILELKRIRIGSLVLGGLRYGEYRELTDAEILTYHTL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagtgcgcttaaataagtttttatctgctgctggcattgcctctcgtaggaaa
tgtgatgaaattattttcgctggagaggttacaataaatggacgtgtagctcaggggcct
tttgttcaggttgatgaccaacatgatcgggttttagtgcgagggaaacctattgcaagc
acgaaaaaggtctattttatggtgcataagcctttgggttttgtttgcacctctgagagg
aagttcccgggaaccaagcttgtgattgatttgttctcccatcttccctatcgggtgttt
actgtgggacgcttggataaggaaacctcgggattgattttagttacgaatgatggggat
tttgcaaataaaattatacatccttcttatgggattaccaaagagtatttactaaaagtt
aatcgcgacgtaatagaaaaagatttgaactccttgatgcagggcacgatgattgatggg
aagcgtgttcgtcctgtggctgtatctaaagttcgtagaggaacgataaagattgttgtc
aatgaagggaaaaaacacgaaatccgtttgtttgcagaggctgcggggttacagatttta
gaactgaagcggattcgtattgggagccttgttttaggtgggttgcgttatggggaatat
cgtgagctcactgatgctgaaatcctgacctatcatacactttaa

DBGET integrated database retrieval system