KEGG   Chlamydia pecorum E58: G5S_0179Help
Entry
G5S_0179          CDS       T01466                                 

Gene name
pgm
Definition
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cpm  Chlamydia pecorum E58
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cpm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    G5S_0179 (pgm)
   01230 Biosynthesis of amino acids
    G5S_0179 (pgm)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    G5S_0179 (pgm)
  Energy metabolism
   00680 Methane metabolism
    G5S_0179 (pgm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    G5S_0179 (pgm)
Enzymes [BR:cpm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     G5S_0179 (pgm)
Exosome [BR:cpm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   G5S_0179 (pgm)
  Exosomal proteins of melanoma cells
   G5S_0179 (pgm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
182738..183424
Genome map
AA seq 228 aa AA seqDB search
MTLLILLRHGQSVWNARNLFTGWVDVPLSAQGIEEAFSAGEALKDLPIDCIYTSTLVRSL
MTALLAMSRHSSQKIPYLIHEDPEHCKMGKIYSTTEEQMMIPVVSSSALNERMYGELQGK
NKQETAEQFGEEQVKLWRRSYKVAPPQGESLYDTKQRVLPYFTQTILPQLHNSKNVFISA
HGNSLRSLIMDIEKLSEEEVLSLELPTGKPIVYSWTGHKFDKLLEPFG
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgactttactcattttacttcgccatggccaatctgtatggaacgcaagaaatttattt
acgggatgggtagatgttcctctgagtgcccaaggaatcgaagaggctttttccgctgga
gaagcacttaaggatctccctatagattgcatttatacctccacattagtgcgaagctta
atgacggcgcttctagcaatgtctcgtcactcctctcaaaaaatcccctaccttatccat
gaggatcctgagcattgcaaaatggggaagatctatagcaccacagaggagcaaatgatg
atccctgttgtttcatcttcagccttaaatgaaaggatgtatggagaacttcaagggaaa
aataaacaagaaactgcggaacaatttggtgaggaacaggtgaagttgtggcgacgtagt
tataaagtcgcccctccccaaggagaaagcctctatgacaccaaacagcgcgttcttccc
tatttcacacaaactattctcccacagctacacaattctaaaaatgtttttatatcagct
catgggaactccttaagatctttgattatggatatagaaaaattaagtgaagaagaggta
ctctctttagagcttcccacaggaaaacctatagtgtattcatggaccggccacaaattc
gacaaacttctagaaccgtttggttaa

DBGET integrated database retrieval system