KEGG   Chlamydia pecorum E58: G5S_0179Help
Entry
G5S_0179          CDS       T01466                                 

Gene name
pgm
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cpm  Chlamydia pecorum E58
Pathway
cpm00010  Glycolysis / Gluconeogenesis
cpm00260  Glycine, serine and threonine metabolism
cpm00680  Methane metabolism
cpm01100  Metabolic pathways
cpm01110  Biosynthesis of secondary metabolites
cpm01120  Microbial metabolism in diverse environments
cpm01130  Biosynthesis of antibiotics
cpm01200  Carbon metabolism
cpm01230  Biosynthesis of amino acids
Module
cpm_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cpm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    G5S_0179 (pgm)
  Energy metabolism
   00680 Methane metabolism
    G5S_0179 (pgm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    G5S_0179 (pgm)
Enzymes [BR:cpm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     G5S_0179 (pgm)
Membrane trafficking [BR:cpm04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    G5S_0179 (pgm)
Exosome [BR:cpm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   G5S_0179 (pgm)
  Exosomal proteins of melanoma cells
   G5S_0179 (pgm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEB41197
Position
182738..183424
Genome map
AA seq 228 aa AA seqDB search
MTLLILLRHGQSVWNARNLFTGWVDVPLSAQGIEEAFSAGEALKDLPIDCIYTSTLVRSL
MTALLAMSRHSSQKIPYLIHEDPEHCKMGKIYSTTEEQMMIPVVSSSALNERMYGELQGK
NKQETAEQFGEEQVKLWRRSYKVAPPQGESLYDTKQRVLPYFTQTILPQLHNSKNVFISA
HGNSLRSLIMDIEKLSEEEVLSLELPTGKPIVYSWTGHKFDKLLEPFG
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgactttactcattttacttcgccatggccaatctgtatggaacgcaagaaatttattt
acgggatgggtagatgttcctctgagtgcccaaggaatcgaagaggctttttccgctgga
gaagcacttaaggatctccctatagattgcatttatacctccacattagtgcgaagctta
atgacggcgcttctagcaatgtctcgtcactcctctcaaaaaatcccctaccttatccat
gaggatcctgagcattgcaaaatggggaagatctatagcaccacagaggagcaaatgatg
atccctgttgtttcatcttcagccttaaatgaaaggatgtatggagaacttcaagggaaa
aataaacaagaaactgcggaacaatttggtgaggaacaggtgaagttgtggcgacgtagt
tataaagtcgcccctccccaaggagaaagcctctatgacaccaaacagcgcgttcttccc
tatttcacacaaactattctcccacagctacacaattctaaaaatgtttttatatcagct
catgggaactccttaagatctttgattatggatatagaaaaattaagtgaagaagaggta
ctctctttagagcttcccacaggaaaacctatagtgtattcatggaccggccacaaattc
gacaaacttctagaaccgtttggttaa

DBGET integrated database retrieval system