KEGG   Chlamydia pecorum E58: G5S_0182Help
Entry
G5S_0182          CDS       T01466                                 

Definition
(GenBank) flagellar M-ring protein
  KO
K02409  
flagellar M-ring protein FliF
Organism
cpm  Chlamydia pecorum E58
Pathway
Flagellar assembly
Brite
KEGG Orthology (KO) [BR:cpm00001]
 Cellular Processes
  Cell motility
   02040 Flagellar assembly
    G5S_0182
Secretion system [BR:cpm02044]
 Type III secretion system
  Flagellar export apparatus
   G5S_0182
Bacterial motility proteins [BR:cpm02035]
 Flagellar system
  Flagellar assembly proteins
   M,S,P and L rings
    G5S_0182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
185500..186459
Genome map
AA seq 319 aa AA seqDB search
MCLLAGALICLWGFGKTSSSPEAPTPKLEKSGAWLKISQAGNLKLCETLAKKEQLEKDLT
IFHPIASAKVALALPSDSEVSHPLKLSVILTLHKDQYLTPMLLFSIADYLCSSFPGLRHE
DITLSDNEGNFYTPELIDTNFLLLFSLEKYLSKIFPKEHFSLSCLPKKEKPTLQLTVNKT
FLEKLSKEHATKLWNHATQYLYQNYGTSHTILKEQLPFTGKLRNRRDISRYVITGLILLS
SLSIVALASLYLAWQAYDRMDEPQKIKRGINIAKLVEIVQKEPPQKIALILSFLDPGKAE
ELLNKLPIEIQHQVLKYKL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtgcttgttagcaggagctctcatttgcctctggggatttgggaaaacttcctcctct
ccagaagccccaacacctaaacttgagaaatcaggagcctggcttaaaatttcccaagct
ggcaacctcaagctctgcgaaacactcgcaaaaaaagaacaactcgaaaaagacctaacg
atttttcatcccatagcctcagcaaaagtcgctttagcattaccttccgactctgaagtt
tcccaccctttgaaactttccgttatccttacactacataaagatcaataccttactcct
atgctactgttttccattgcggattatctttgcagtagcttcccaggtctacgtcatgaa
gacatcaccctctccgataatgaagggaatttctacactcctgaacttatagatacaaat
tttcttcttctgttttccttagaaaaatacctctccaaaattttccctaaggaacacttt
tccctctcttgtctcccgaaaaaagagaagcctacgctgcaacttacagtaaataaaacg
ttcctagaaaagctctccaaggaacatgcgacaaaactttggaaccatgccacacaatac
ctctaccaaaattatggcaccagtcatacaattctcaaagagcagctcccctttacaggg
aaactcaggaaccgtcgggatatctccagatatgtaattacagggctcattctcctttca
agcttaagcattgttgctcttgcgagtttgtatcttgcctggcaagcatatgatcgcatg
gatgaacctcaaaaaataaaacgaggaataaatatcgcaaaactggtagagatcgtgcaa
aaagagcctccacaaaagattgcgttaattctttcatttttagatccagggaaagctgaa
gagctcttaaataaacttcctatagagatacaacatcaagtactgaaatataaactttag

DBGET integrated database retrieval system