KEGG   Chlamydia pecorum E58: G5S_0193Help
Entry
G5S_0193          CDS       T01466                                 

Definition
(GenBank) helicase, swi/snf2 family
Organism
cpm  Chlamydia pecorum E58
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(198706..202209)
Genome map
AA seq 1167 aa AA seqDB search
MLNFRKLRRDFSANILQEGKELFEQGAVVNAKILSINGETVCIGAQIRGLYENVYECEIE
VDRSESDTIDSNCDCSYNFDCQHIVALLFYLEQYFNEMVVAYAREADLDTNQEINEEEKK
ELQETFVVAATKEEERKDREHQKEILREYIHAANALSANPFFLPLEYLEKDSAELAVLFV
SATDETFVANNQPIEFQLVLRLPCRSKPFHVPNIRTFLEGVLYQEPIVLNGRRFFFTMQS
FNASDRKLIDLLIRYVRYPSQTTEEKLLKSAYLMHASLGVILAKMFEHQLANRGGGQLGE
KETFVGFFCGNLEEPLYWSTAPARMKFNLDFFDTPYKAVLMSPMILVDNDEVLPEHVLLL
ESDAPGMIHRNVYHRFAPQIKRAHLRSFARLRDITIPEALFGTFRENALPVFQEYAEVEN
VHLLNSFVTLPYVDEVRAICDMSYLDGELEAKLYFLYGSLRIPAASMALQYADVRAFICD
EGILARNLVEERKITEEVFSGFIYDERDGAFHVKSEKKIVEFMTETIPANQHRITFNCPE
NLSDQFIYDETVFDLAFREGTDINYYEAELKVHGLLKGVSLDLLWDCISAKKCFLELPKK
GQQVKNARRGNAFSGNKLPCILVLDLERIATIVQIFNEIGFKVLDNLTEKCPLWSLTGIS
EEQFAGLPVNFSMTEKLKGIQQQIRGEVAFNFQDVPKQIQATLRSYQTEGVHWLERLRKM
HLNGILADDMGLGKTLQAIIAVTQSKLEKGQGCSLIVCPTSLVYNWKEEFRKFNPEFKTL
VIDGIPSQRRKQIQSLADYDVAITSYNLLQKDIELHKDFHFDYVVLDEAHHIKNRTTRNA
KSVKMIQSDHRLILTGTPIENSLEELWSLFDFLMPGLLSSYDRFVGKYIRTGNYMGNKAD
NMVALKRKVSPFILRRMKEDVLEDLPPVSEILYHCHLTDSQRELYQSYATSAKQELSRLV
KQEGFERIHIHILATLTRLKQICCHPAIFAKDSPEPGDSAKYDMLMDLLSSLVDSGHKTV
VFSQYTKMLSIMKKDLEIRGVPFVYLDGSTKNRLELVNKFNEDPNLLVFLVSLKAGGTGL
NLVGADTVIHYDMWWNPAVENQATDRVHRIGQSRSVSSYKLVTLNTIEEKILTLQNRKKS
LVKKVINSDDEVVSKLTWEEVLELLQI
NT seq 3504 nt NT seq  +upstreamnt  +downstreamnt
atgcttaattttcgcaaattacgtcgagatttttcagccaatattttgcaggaaggcaag
gaactttttgaacaaggagcggtggttaatgcaaaaattctctctataaatggagagaca
gtgtgtattggtgcgcagattcgtggtctttacgagaatgtgtatgagtgtgaaattgaa
gtcgacagatcagaatcagacaccatagattccaattgtgactgttcctataattttgat
tgtcagcatatcgtggcattgctgttttatctagagcaatactttaatgagatggtggta
gcctatgctagagaggctgatcttgacaccaatcaagagatcaatgaggaagagaaaaaa
gagcttcaggaaacgttcgttgtagcagcaacaaaagaagaagagaggaaagatcgcgag
catcaaaaggaaattcttagagagtacattcatgctgccaatgctttaagtgcaaacccg
ttctttttgcctttagaatatttagaaaaggattctgcagagcttgcggttttatttgtc
tcagctacagatgaaacatttgtagcaaataaccagcccatagagtttcagttggtttta
cgtcttccctgccgttctaagccctttcatgtccccaatattcgtactttcttagaagga
gtcctttatcaggagcctatagtgcttaatggacgtcgttttttctttacgatgcagtcg
ttcaatgcttcggatagaaaacttatagatctattgattcgctatgtacgctatcccagc
cagacaacggaagaaaagttattaaaatctgcatatttgatgcatgcttctctgggagtc
attttagcgaagatgttcgaacatcaattagcaaatcgaggaggggggcagcttggagaa
aaggaaacatttgtaggtttcttttgtgggaatttagaagaacctctctattggtccaca
gcgccggcacgcatgaagtttaatttagatttttttgatacaccgtataaagctgttttg
atgagccccatgattttggtagataatgatgaggttcttcctgagcacgtcttgctttta
gagtctgatgccccaggaatgatccatcggaacgtgtatcatcgatttgctccacaaatc
aaacgtgcgcatctacgctcttttgctcgtttacgggatatcacgatccctgaagcttta
ttcgggacatttcgagaaaatgctcttcctgtatttcaagagtatgctgaagtcgaaaat
gtgcatcttttgaattcctttgtaaccttgccttatgtggatgaggtccgtgcgatctgt
gatatgagctatttggacggagaattagaagcaaagctatatttcctttatgggtctttg
cgtatccctgcagcttctatggctttacagtatgcagatgtgcgagcatttatttgtgat
gagggcattttagcaagaaatcttgtggaagaacgtaagattacagaagaagtgttctca
gggttcatttatgacgagcgtgatggggcttttcatgtgaaaagtgaaaagaagatcgtg
gagtttatgacggaaacgatccctgcgaatcagcatcgcatcacctttaattgtccggaa
aacctttcggatcaatttatttatgatgaaactgtgtttgaccttgcttttagagagggt
acagatatcaattactacgaagcagaacttaaagttcatgggttgcttaaaggggtgagt
ctggatcttttatgggattgcattagtgcaaaaaaatgctttttggaacttcctaagaaa
ggtcagcaggtaaagaatgctcgtcgtgggaatgcttttagtgggaacaagttgccttgc
attttagttttagatttggaaaggatcgcgacaattgttcaaatttttaatgaaattggg
tttaaagttttagataatcttacagaaaagtgccctttgtggagtttaacaggaatttct
gaggagcagtttgcaggcctacctgtgaatttctctatgacagagaaactcaaagggatt
cagcagcaaattcgtggagaagttgcttttaacttccaagatgttcctaagcaaattcaa
gcaactttgcgtagttatcaaacggaaggagtacattggctagagcggctaagaaaaatg
catcttaatgggattttagctgatgatatggggttagggaagacgctccaggcgattatt
gctgttacgcaaagtaagcttgaaaaagggcaagggtgttctcttattgtgtgcccaacc
tctttggtttataattggaaagaggaatttcgcaagtttaatccagagttcaaaacttta
gtgattgatgggatcccttcacaaagacggaagcaaatacaatctcttgcggattatgat
gtagcgataacgtcttataatcttttacagaaagatatagagcttcataaggacttccat
tttgactatgtagtgttggatgaagctcatcatattaaaaacagaacaacgcgtaatgca
aaatctgtgaagatgattcagtcggaccatcgattgattttaacaggaactcctatagag
aactctctagaagaattatggagtctgtttgacttcttaatgccggggctgcttagtagc
tatgatcgttttgtaggcaagtatatccgcaccggcaattatatgggcaataaagcggat
aatatggtggcgttaaaaagaaaggtctccccatttattttgcgtcgtatgaaagaggat
gttttagaagatctccctcctgtttcagagatcctttatcattgtcatcttacagattcc
cagcgtgagctttatcaatcttatgcgacctctgctaagcaggaactgtctcgtttagtc
aagcaagaaggatttgaaagaattcatattcatattcttgccacattgacgagattaaaa
cagatctgttgtcatccggcaatttttgcaaaggattctccagaaccaggggactctgcg
aaatatgacatgcttatggatttactgtcatccttagtggattctgggcataaaacggtt
gtgttcagtcaatatacgaagatgctttcgattatgaagaaagacttggagattcgcgga
gttccatttgtgtatttggatggttccaccaagaacagattggagttagtcaataagttt
aatgaagatcccaacttgttggtatttctggtctctttaaaagctggaggcacgggatta
aacttagttggcgcagatacagtgattcactatgatatgtggtggaatcctgctgtagag
aaccaggcgacagatagggtgcatcgtattggacagagccggtcggtctcgtcatacaaa
ttggtgacgttaaatacgatcgaagaaaagattttaacactacaaaacaggaaaaagagc
cttgtaaagaaagtcatcaactctgatgatgaagtcgtttccaagttaacttgggaagaa
gtcttagaattgttacaaatatga

DBGET integrated database retrieval system