KEGG   Chlamydia pecorum E58: G5S_0199Help
Entry
G5S_0199          CDS       T01466                                 

Definition
(GenBank) GTP-binding protein engA
  KO
K03977  
GTPase
Organism
cpm  Chlamydia pecorum E58
Brite
Ribosome biogenesis [BR:cpm03009]
 Prokaryotic Type
  GTPases
   G5S_0199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
207250..208701
Genome map
AA seq 483 aa AA seqDB search
MLRIAILGRPNVGKSSLFNRLCKRSLAIVNAEEGTTRDRLYGSAQICDSTIQVIDTGGVN
KDSQDHFQKHIFKQALVGAKEADLLLLVVDIRCGITEQDMQLAKLLRPLNKPIILVANKA
DSRKDEFGIHELYSLGIPEIVVTSAAHGKHIDTLVHKIQRLAKIPEIQPESPQDDEDLHE
EKELLCDKESEAIFEEVFDENHESFFVEDPQLPPLETNQPLKIALIGRPNVGKSSIINGL
LNEERCITDNIPGTTRDNVDILYTKEDRSYLFIDTAGLRKMKSVKNSVEWISTSRTEKAI
SRADICLLVVDATQGLSSYDKRILSLISKEKKPHILLVNKWDLMHSIRMEHYCRDVLATD
PYLGQARILCISALKKRNLSQIFRAIDELHEVISRKVPTPMVNKTLASALQKHHPQVING
RRLRIYYAIQKTSSPFQFLLFINRKSLLTKHYENYLKNSLKTTFKLHGIPFDLTFKEKPK
RTN
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgaattgccatcttaggaaggcctaatgtggggaaatcttcccttttcaatagg
ctttgcaaacgttctttggcgatagtcaatgctgaagaagggacaacgcgcgaccgtcta
tatgggtctgcgcaaatttgcgactctacaatacaggtgattgatactgggggtgtcaat
aaagactctcaggaccatttccaaaagcatattttcaaacaagcgcttgtgggagcaaag
gaagcagatcttttgcttttagtcgtagacatccgctgtgggattacagagcaggatatg
cagttagccaagttgctgcgtcctttaaacaagccgatcatcctcgttgctaacaaagca
gatagccgtaaggatgaatttggtatccatgagctgtactccctgggaattcctgagatt
gttgtgacctctgcggctcatgggaaacatattgatactcttgtgcataaaatccaacgg
cttgcaaaaattccagagatacagcctgagtctcctcaggatgatgaagatcttcatgaa
gagaaagagcttctctgtgataaggagtctgaagctatctttgaggaagtttttgatgaa
aatcacgaaagttttttcgttgaggatcctcagcttccccctctagaaaccaaccaaccg
ttaaaaattgctttaattggcagaccaaatgtagggaaatcttcaattattaacgggcta
ttgaatgaagagcgctgcatcacagacaatatccccgggaccacccgagataatgtcgat
atcctctatacaaaagaagaccgttcttatttatttatagatacggcgggtcttaggaaa
atgaaaagcgtaaaaaattctgtggagtggatttccacatcgcggacagaaaaagccatc
tcccgtgcggatatctgcctccttgttgtagatgcaacccaagggctctcctcctacgat
aagcgcatcctttctttaatttctaaagagaaaaaaccccacattctccttgtaaacaag
tgggacttaatgcactccatccgtatggagcactattgtcgtgatgttcttgctacagac
ccttatttaggacaggcaaggatcttatgcatctctgctcttaaaaaacggaatctctct
cagatcttccgagctatagatgagctccatgaagtgatctctcggaaagtccctactcct
atggtgaataaaaccttagcttctgccctacaaaaacaccatcctcaggtaatcaacggc
cgaagactaagaatttactatgccattcaaaaaacctcttctcctttccaatttttatta
tttattaatagaaaatccttacttacaaaacactatgaaaactatttaaaaaactcatta
aaaacaacatttaaactacacggtataccctttgatttaacttttaaagaaaaaccaaaa
agaacaaattaa

DBGET integrated database retrieval system