KEGG   Chlamydia pecorum E58: G5S_0222Help
Entry
G5S_0222          CDS       T01466                                 

Definition
(GenBank) Putative outer membrane protein
Organism
cpm  Chlamydia pecorum E58
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(232351..232716)
Genome map
AA seq 121 aa AA seqDB search
MKIQKRKQAITLIEMMVVITLIGIVGGALAFNMRGSIHKGKVFQSEQTCAKVYDILMMEY
ASGGASLKDILAQKEKILEEAAWCKEGKKLLKDAWGEDLIVQLNEQEDDLVIFSKRAKAS
K
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcagaaaaggaaacaggcaatcacattgatcgagatgatggttgtcatcacc
ctcatagggattgttggaggggcattagcgtttaatatgcgtggaagtatccataaaggg
aaagtatttcagtccgagcagacatgtgcgaaggtgtatgacattttaatgatggaatat
gcctcaggaggagcatccctgaaagatattcttgcacaaaaggagaaaatcctagaagag
gcagcttggtgtaaagaaggcaaaaagcttttaaaagatgcttggggagaggatcttatc
gttcaactcaatgagcaggaggacgacctagttattttttccaagagagccaaagcttct
aagtag

DBGET integrated database retrieval system