KEGG   Chlamydia pecorum E58: G5S_0224Help
Entry
G5S_0224          CDS       T01466                                 

Definition
(GenBank) Type II/IV secretion system protein
  KO
K02454  
general secretion pathway protein E
Organism
cpm  Chlamydia pecorum E58
Pathway
Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cpm00001]
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    G5S_0224
Secretion system [BR:cpm02044]
 Type II secretion system
  General secretion pathway protein [MD:M00331]
   G5S_0224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(233929..235419)
Genome map
AA seq 496 aa AA seqDB search
MADDLLNYKLLDLFPYTFLKKHCCLPLEEEGDVLVIAHAPTTSLVALDEIRLLSKKNVRF
LIKEEAEILQSLQKLYSTRGGKASDMLLTMEQETSPTMEAQEDLLENTSSAPVVRLLNLI
LKEAIEERASDIHFEPSEEVLRIRYRIDGVLHDRHSPPSHLRSALITRLKVLAKLDIAEH
RLPQDGRIKLQLGGQEVDMRVSTVPVIHGERVVLRILDKRNVILDIAGLCMPEAMEREFK
ENIKAPEGILLVTGPTGSGKTTTLYGVLQELSGPFTNIMTIEDPPEYKLAGIAQIAVKHK
IGLSFSRGLRHLLRQDPDILMVGEIRDQETAEIAIQAALTGHFVVSTLHTNDAISAVFRL
IDMGVEPYLLSATLVGVVAQRLVRKLCPHCKKTCSPDEHEKAFLLSLKEDPHRQVYHGQG
CSACFHSGYKGRQGIYEFFRPDAHLRSEIAQRQTYQALRDHAYTSGFCPLLEHGVALALS
GQTSLSEVLRVTRHYD
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggccgatgatctcctgaattataagcttttagaccttttcccctatacgtttctaaag
aaacactgctgtcttcctcttgaagaagagggcgatgttcttgtaattgctcatgcaccg
acgacctcccttgtagctttagatgaaattcggttgttatcgaaaaagaacgtacgcttt
cttataaaagaagaagctgaaatcctacagagtctgcaaaagctttatagcacaagaggc
ggaaaagcttctgatatgctgctaacgatggagcaggaaacctcccccacaatggaagct
caggaagatctccttgaaaatacgagttcggctcctgttgtccggctgttaaatttgatc
ttaaaagaagcgatcgaagagcgagcttcagatattcattttgagccttccgaagaggta
ttgcgtatcagatatcgtatagatggagttcttcatgaccgccattctcctccgtcacat
ctacgctctgcactcatcacgcggcttaaagttttagctaagttggatattgcggagcat
cgccttccccaagatggtaggataaagctgcagcttggtggacaggaagtggatatgcgt
gtcagcacagtgcctgtgattcatggggaaagggtcgttttgcggatcttagataagcga
aatgtgattttagatattgcagggctctgcatgcctgaagcaatggagagggaatttaaa
gaaaatattaaagctccagaagggattttgctagttacgggccctacgggaagtgggaaa
actacgacgttatatggagtgttgcaggagctctcaggaccgtttacaaacattatgaca
atcgaggatcctccagaatataaactcgcagggatcgcacagatcgctgtaaagcataaa
atcggtctgtcgttttcgcgtgggttacggcatttgttgcgtcaagatccggatatttta
atggtgggagaaatccgagatcaggaaacagcagagatcgccatacaggcagctctaacg
ggacatttcgtagtgagtaccttgcatacaaatgatgccatctcggctgtatttcgtttg
atagatatgggagtggagccttatttgctttccgcaacccttgttggagtggtggcacaa
aggttggtaagaaaactttgtccccattgtaaaaaaacctgctccccagatgagcatgaa
aaggcgtttcttctttcccttaaggaagaccctcatcgccaagtataccatggacaggga
tgctcggcgtgttttcattctggatacaaaggccgacagggaatctacgagtttttccgt
ccagatgcgcatctgcgctcagagattgctcagaggcaaacatatcaggcgttgcgagac
catgcctataccagtggtttttgtcctttgttagagcatggtgttgctttagccctttct
gggcaaacctcattatccgaggttttgagggtaacaagacactacgattaa

DBGET integrated database retrieval system