KEGG   Chlamydia pecorum E58: G5S_0228Help
Entry
G5S_0228          CDS       T01466                                 

Definition
(GenBank) DNA mismatch repair protein mutL
  KO
K03572  DNA mismatch repair protein MutL
Organism
cpm  Chlamydia pecorum E58
Pathway
cpm03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cpm00001]
 Genetic Information Processing
  Replication and repair
   03430 Mismatch repair
    G5S_0228
DNA repair and recombination proteins [BR:cpm03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    Molecular matchmaker
     G5S_0228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_mis_repair MutL_C HATPase_c_3 HATPase_c
Motif
Other DBs
NCBI-ProteinID: AEB41243
Position
complement(240145..241872)
Genome map
AA seq 575 aa AA seqDB search
MSQRSPIQLLDTITVNQIAAGEVIENAASVVKELIENALDAGADEIELETLGGGQGLIIV
KDNGCGMTQEDVSLALQRHATSKIRDFSDIFSLHSFGFRGEALPSIASISRMEILSSLQE
GEGVRCVIQGGESVLCEPAARRRGTTITVDSLFYNVPVRKGFQKSPHVDRMLMRKMLENR
ILATEAVGWSWISERSQELLVLKHQGFADRVALVMGENFMQEALEIDTHDGDVRIKGFFG
SLNFHRPSRQGQRIFVNDRPVESGFISRKVGEMFSVLLPVQRYPVFVLKLYLPPARCDFN
VHPQKTEVRIFQEELVGEKLKICLSEVLMRSQQIPREPQPPSCISEVPFPTPTIFEPRDL
SEDLLEKEVGGFSLEEALPPKQEFAQGQKNSLQIDWLEACNVRFLTSLGKVVLAEDFEGV
YAIFPDVLRKHLFYLSLQEPQQHKSQTFLIPLTLQVTPQESQVLLLYMEELCQFGIELSQ
VGPQVFIIESAPEFIEEEELKAWMLLLASEQRERVGREAFLMFIRETLSRGVFSKSPRVF
DASWLTLLWGLGKPERAFDGTQIYRRLLDTDFLGG
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaaagaagtccgattcagcttttggatacaattactgtgaaccaaattgctgca
ggggaagtgatagaaaatgcggcttctgtggttaaggagttaatagagaacgccttggat
gctggagcagacgaaatcgagcttgagactctaggaggtgggcaggggctgatcattgta
aaggacaatggctgtgggatgacgcaagaggatgtttctttagcgttgcaacgtcatgcg
acctcgaaaattcgtgatttttcagatattttttctttacatagttttggttttcgtggt
gaggctttgccttccatagcctctatctctaggatggagatcctttcctctttgcaagag
ggagagggggtgcgctgtgtgattcaagggggggagagtgtattatgtgagcccgcagcg
aggcggcgagggactacaataactgtggactctttattttataatgtccctgtgaggaag
gggtttcaaaagagtcctcacgtggatcgcatgttgatgcggaagatgttagagaatcgc
attttagctacagaagctgtgggttggtcttggattagtgaaagaagccaagagttgcta
gtgctcaagcatcagggatttgcggatagggtcgcgttagtgatgggagagaattttatg
caggaggctctcgaaattgatacgcatgatggagatgttcgcattaagggattttttggt
tcgttaaactttcatcgtccttcccgacaagggcaaagaatctttgtaaatgatcgtccc
gtagaatctggatttatttctcgcaaggtaggggagatgttttctgtcttgctgcctgta
caacgttatcctgtatttgtattaaaattatatctgcctcccgcaaggtgtgactttaat
gtgcacccacaaaaaacagaagtgaggatttttcaagaggagctcgtgggggaaaaactt
aagatatgtttatccgaagtgctcatgcgttcacaacaaatcccaagggagcctcaacct
ccttcttgtatctcagaggttccttttcctacgcctacaatttttgagcctagagacctc
tctgaggatctcctagagaaggaagtggggggcttttctctagaagaggcgctccctcca
aaacaagaatttgcacagggacaaaaaaattctttgcaaatagattggttagaagcgtgt
aatgttcgatttttaacttctttaggaaaggtagtcttagcagaagattttgagggtgtg
tatgccattttccccgatgtgttacggaagcatttgttttatttgtctttgcaagaaccg
cagcaacataaaagccaaacgtttttgattccacttactttgcaggttacgcctcaggaa
agccaagtgcttttgttatatatggaagagttgtgtcagtttgggatagaactttctcaa
gtaggaccccaggtatttatcatcgaaagtgctccagagtttattgaagaagaggaactg
aaggcatggatgttattgctcgcttcagaacagcgtgagagggtaggtcgtgaagcattt
ttgatgtttatacgagaaacgctgtctcgtggggtcttttctaaaagtcctcgcgttttt
gatgcttcttggttaactcttctttggggcttggggaagccagaacgagcttttgatggg
acacaaatttatcgtcgacttttagatacagattttcttggaggatag

DBGET integrated database retrieval system