KEGG   Chlamydia pecorum E58: G5S_0239Help
Entry
G5S_0239          CDS       T01466                                 

Definition
(GenBank) conserved hypothetical protein
Organism
cpm  Chlamydia pecorum E58
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
250629..251183
Genome map
AA seq 184 aa AA seqDB search
MASKAKTLELEDNVFFLLEGNLKRIFATPIGYTTFREFQNVVFNCANGQQEAANFFFEML
INGKLTQEVTPHQKQAAQKLIAEFMMPIRVSKDIHERGEFINFITSDMLAQQERCIFLNR
LARVDGQEFLLMTDVQNTCHLIRHLLARLLEAQKNPIGEKNLLEIQEEIESLKNHFEELS
KALQ
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgaaagcaaaaacactcgaacttgaagacaatgtatttttccttcttgaggga
aatttaaaaaggatttttgcgaccccaattggttatacgacattccgagagtttcaaaat
gtagtctttaattgtgccaatggccagcaagaggctgcgaactttttctttgaaatgcta
attaatggaaagctgacacaagaggtaactcctcaccaaaaacaagctgcgcaaaagctc
attgcagagttcatgatgccaattcgtgtctctaaagacatccatgaacgtggggaattt
attaacttcatcacttcagatatgctagcgcagcaagaacgctgtatttttttaaatcgc
ctagctcgtgtagatgggcaagagttcctcctcatgacagatgtacaaaatacctgccac
cttatccgtcatttacttgctagacttttagaagcacagaagaatcccattggggaaaaa
aaccttctagaaattcaagaagaaattgaatctttgaaaaatcactttgaggagctttca
aaagcccttcaataa

DBGET integrated database retrieval system