KEGG   Chlamydia pecorum E58: G5S_0242Help
Entry
G5S_0242          CDS       T01466                                 

Gene name
eno
Definition
(GenBank) enolase
  KO
K01689  
enolase [EC:4.2.1.11]
Organism
cpm  Chlamydia pecorum E58
Pathway
Glycolysis / Gluconeogenesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cpm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    G5S_0242 (eno)
  Energy metabolism
   00680 Methane metabolism
    G5S_0242 (eno)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    G5S_0242 (eno)
Enzymes [BR:cpm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     G5S_0242 (eno)
Messenger RNA biogenesis [BR:cpm03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     G5S_0242 (eno)
Exosome [BR:cpm04147]
 Exosomal proteins
  Proteins found in most exosomes
   G5S_0242 (eno)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
254317..255597
Genome map
AA seq 426 aa AA seqDB search
MCDATISNIQAREVLDSRGYPTVAVKVITNLGTFGEACVPSGASTGVHEALELRDHDASR
YQGKGVLQAVKNVKEVLLPLLHGYSVFDQILLDSMMVDADGTPNKSKLGANAILGVSLAS
AKAAAATLKRPLYRYLGGCFASTLPCPMMNLINGGMHADNGLEFQEFMIRPIGAHSMHEA
VSMGADVFHALKNLLKSRHLATGVGDEGGFAPNLRSNAEALELLMTAIEAAGFVPGEEVS
LALDCAASSFYEAVTKTYHGRPYDAQIEILKELCERFPIDSIEDGLAEEDYEGWEKLTQE
LGDQVQLVGDDLFVTNPGLIAEGISKNLANAVLIKPNQIGTLTETSEAIQLAHSHGYSTI
LSHRSGETEDTTIADLAVAFSTGQIKTGSLSRSERIAKYNRLLAIEEELGQESLFKDSNI
FASYEE
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgacgccaccatttccaatatccaagcgcgagaagttctagattctcgaggctac
ccgacagtagctgttaaagtcattaccaacttgggaacttttggagaagcatgcgttcct
tctggagcttctacaggagtccatgaagctttggaactgcgcgatcacgatgcttctaga
tatcaagggaagggagtactacaagcagtaaaaaatgttaaagaagttcttcttcctctg
ctacatggctatagcgtctttgatcagatccttttggattctatgatggtagatgctgac
ggcacaccaaataaatcaaaattaggagccaatgcgattctaggggtttctttagcgtca
gcgaaagcagcagcagcaactctgaagcgtcctctatatcgctatctcggagggtgcttt
gcctctacccttccttgccctatgatgaaccttatcaatggcgggatgcacgcagataat
ggcctggaatttcaagaatttatgatccgtccgattggggcgcactctatgcacgaggcg
gtatctatgggggcggatgtattccatgctttgaaaaacctcttaaagtcacgtcattta
gctacaggagtaggcgatgaaggaggctttgctccgaacttacgctccaatgcagaagct
ttagagcttctcatgactgcaatagaagccgcaggttttgtccctggggaggaagtttct
ttagctctagattgcgcagcatcttctttttacgaagcagtgacaaaaacctatcacggc
agaccttatgatgcacagatagagattcttaaagagctttgcgaacggtttcctatagac
tctattgaggatggcttagcggaggaagattatgaaggatgggagaaattaacccaagag
ctcggcgatcaagttcaacttgttggagatgatttatttgtaaccaatcctggtttaata
gccgaagggatcagtaaaaatcttgccaatgcggtattgattaagccaaatcagatcgga
acactcacagaaacttctgaggcgatacagcttgcccattctcatggatatagcactatt
ctctcacaccgctctggggaaactgaagatactaccattgcagatcttgctgtagcattt
tccacaggtcagataaaaacaggatctttatcacgttctgaacgcatcgccaaatataac
aggctcttagcaatagaagaagagctcggtcaggaaagtctctttaaagattccaatatt
tttgcctcttacgaagaatag

DBGET integrated database retrieval system