KEGG   Chlamydia pecorum E58: G5S_0248Help
Entry
G5S_0248          CDS       T01466                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
cpm  Chlamydia pecorum E58
Pathway
cpm00020  Citrate cycle (TCA cycle)
cpm00190  Oxidative phosphorylation
cpm00650  Butanoate metabolism
cpm01100  Metabolic pathways
cpm01110  Biosynthesis of secondary metabolites
cpm01120  Microbial metabolism in diverse environments
cpm01130  Biosynthesis of antibiotics
cpm01200  Carbon metabolism
Module
cpm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cpm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    G5S_0248 (sdhB)
   00650 Butanoate metabolism
    G5S_0248 (sdhB)
  Energy metabolism
   00190 Oxidative phosphorylation
    G5S_0248 (sdhB)
Enzymes [BR:cpm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     G5S_0248 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     G5S_0248 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_7 Fer4_10 Fer4_16 Fer4_9 Fer2_4 Fer4_13 Fer4_3 Fer4
Motif
Other DBs
NCBI-ProteinID: AEB41261
Position
complement(262779..263558)
Genome map
AA seq 259 aa AA seqDB search
MEPKNTFILKIYRGMPGNQYWESFELPLHPGENVISALMEIEKRPINTQGEVVDPVVWEQ
GCLEEVCGSCAMLVNGVPRQACTALIKEYIDTTQSREITLAPLTKFPLVRDLIVDRSVMF
ENLQEIQGWVAADVDGETFGPKVTPEQQELLYTLSMCMTCGCCAEACPQVNAHNDFIGPA
AISQVRYFNSYPGDKRSEERLRRLMGKDGIRGCGQAYNCVRVCPKKLPLTESISIMGRET
SRFSLRKVFSSLFGKKKKT
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggagcctaaaaatacgtttattttgaagatttatcgtggcatgcctggaaaccagtat
tgggaaagcttcgagcttcccctacatcctggggaaaacgtgattagcgcccttatggaa
atcgaaaaacgcccgataaatacccaaggagaagtagtagatcctgtagtgtgggaacag
ggatgcctcgaggaggtttgtggttcgtgtgcgatgttggttaatggtgttcctcgtcag
gcatgtactgcattgataaaagaatatatagatactacacagtctcgagagattacccta
gcgcctctgacgaagttcccccttgtgcgggatcttatcgtggatcgttctgtaatgttt
gagaaccttcaggagatccaagggtgggtagctgcagacgttgatggggagacctttggc
cctaaggtcactcctgagcagcaggagcttctctatacgttatctatgtgcatgacatgt
gggtgttgtgctgaggcctgtccccaggtaaatgcacataatgattttatcggccctgca
gcgatttcccaagtccgttattttaattcttaccctggggataagcgctctgaagagcgc
ttgcgtaggctcatggggaaagacggtattcgcggttgtgggcaagcatataattgcgta
agggtctgccctaaaaagctccctttaacagagagcatttctattatggggagggaaacc
tcgagattttctttaaggaaggttttctcttcactctttgggaaaaagaaaaaaacctaa

DBGET integrated database retrieval system