KEGG   Chlamydia pecorum E58: G5S_0249Help
Entry
G5S_0249          CDS       T01466                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase or fumarate reductase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
cpm  Chlamydia pecorum E58
Pathway
cpm00020  Citrate cycle (TCA cycle)
cpm00190  Oxidative phosphorylation
cpm00650  Butanoate metabolism
cpm01100  Metabolic pathways
cpm01110  Biosynthesis of secondary metabolites
cpm01120  Microbial metabolism in diverse environments
cpm01130  Biosynthesis of antibiotics
cpm01200  Carbon metabolism
Module
cpm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cpm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    G5S_0249 (sdhA)
   00650 Butanoate metabolism
    G5S_0249 (sdhA)
  Energy metabolism
   00190 Oxidative phosphorylation
    G5S_0249 (sdhA)
Enzymes [BR:cpm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     G5S_0249 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     G5S_0249 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like DAO FAD_oxidored FAD_binding_3 NAD_binding_8 Thi4 Pyr_redox Pyr_redox_3 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AEB41262
Position
complement(263570..265447)
Genome map
AA seq 625 aa AA seqDB search
MGNRRVIVVGGGLAGLAAAIQLADRGVLVELVSLTKVKRSHSVCAQGGINAALNLKSEEE
DSPYIHAYDTIKGGDFLADQPPVLEMCLTAPRIIRMLANFGCPFNRSASGDLDVRRFGGT
LYHRTVFCGASTGQQLMYTLDEQVRRRESAGKIIKRENHEFLRLVTNAEGRACGIILMNL
FNNRLEVLKGDAVIVATGGPGVIFKMSTNSTFCTGAANGRLFLQGMTYANPEFIQIHPTA
IPGRDKLRLISESVRGEGGRVWVPGDASKKILFPDGSERPCGKSGEPWYFLEEMYPAYGN
LVSRDVGARAILQVCEAGLGVDGKMEVFLDVTHLPKETLHKLEVVLDIYKKFTGDDPVTT
PMRIFPAVHYSMGGAWVDWPAADDPDREGRFRQMTNLPGCFNCGESDFQYHGANRLGANS
LLSCIFAGLVAGDEAARYIEVFGPALGSSRVYEEALHIEKEENAKILSRKGKENIFVLHE
EIAAIMVRNVTVKRNNHDLQKTLEHLKEFRERLSRVSVHDSSKFANKSFHFIRQMRPMLE
LSLAITKGALLRNEFRGSHYKPEFPKRDDEHWLKTTLASYHPEEPEITYCPVDTRHVAPS
LRDYTKSSTGKIVLDNLPKNIRLPI
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatcgtagagttattgttgtcggtggaggattggcagggttggctgcagcaatt
cagctggcagatcgtggtgttcttgtagagcttgtttctctcacaaaagtaaagcgttcc
cattctgtgtgtgctcagggagggattaacgcagcactcaatctcaagtcagaagaggaa
gactctccctatatacatgcttacgatacaataaaaggaggggatttccttgcagatcaa
cctcctgttttggagatgtgcctcacagctccaaggattatccgcatgttggcgaacttt
ggctgtccctttaatcgtagtgcttctggggatttagatgtccgtaggtttggagggact
ttatatcaccgtacagtcttttgtggtgcctctacgggccagcagctgatgtatacctta
gatgaacaagtgcgcaggagagaaagtgcagggaaaatcataaaaagagaaaaccatgag
tttcttcgtcttgtgactaatgccgagggaagggcttgtgggatcatcttgatgaacctg
tttaacaaccgcttagaggtgcttaagggagacgctgtgattgttgctacaggaggacct
ggagttatctttaagatgtctacgaactccacgttttgtacaggtgcagcgaacgggagg
ctctttttacaaggcatgacttatgcaaaccctgagtttattcagattcatcctacagct
atccctggtcgggataagcttcggttaatctctgagtcggttcgtggagaaggagggcgc
gtgtgggtccctggagatgcttctaagaagatcctcttccctgatggctcagaaagacca
tgtggaaagagtggagagccttggtatttccttgaggagatgtatccagcttatgggaac
ctcgtcagtagagacgttggagcacgggcgattttgcaagtttgcgaggccggattaggc
gtggatggcaaaatggaggtctttttggatgtgacgcatttgcctaaagaaactctgcac
aaactagaagtcgttttagatatttataagaagtttacaggtgacgatcccgtcacaact
cctatgaggattttccctgcggtacattattcgatgggaggggcttgggtagattggcct
gctgctgatgatcctgatcgagaagggcggttccgacagatgactaatctcccaggttgt
tttaactgtggggagtctgatttccaatatcatggagcgaatcgtctaggggcgaattct
ttattatcatgtatttttgctgggcttgttgctggagatgaagctgcacgctatatagag
gtgtttggtcctgctttagggagctctagagtatatgaagaggctttacatatagagaaa
gaagaaaatgccaagatcctttcgagaaaaggaaaggaaaatatctttgtattacacgag
gaaattgccgctataatggtgcggaacgtgacagtaaagcgtaataaccatgatcttcaa
aaaactttagagcatcttaaggagtttcgtgagaggctttctcgtgtttctgttcatgac
tcttcgaagtttgcaaacaagtcttttcatttcatccgtcagatgcggccgatgttagag
ctttctttagcgattaccaagggagctctcttgcgtaatgaatttcgaggttcccattat
aagccggagttccctaagcgtgatgatgaacattggctaaaaacgaccttagcgtcttat
catcctgaagagcctgagattacctattgtccagtggatacacgccatgtcgctccctct
ttgagggactacactaaatcttcaacaggaaagattgttttagacaaccttcccaaaaac
attcgcctgcccatataa

DBGET integrated database retrieval system