KEGG   Chlamydia pecorum E58: G5S_0249Help
Entry
G5S_0249          CDS       T01466                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase or fumarate reductase, flavoprotein subunit
  KO
K00239  
succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
cpm  Chlamydia pecorum E58
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cpm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    G5S_0249 (sdhA)
   00650 Butanoate metabolism
    G5S_0249 (sdhA)
  Energy metabolism
   00190 Oxidative phosphorylation
    G5S_0249 (sdhA)
Enzymes [BR:cpm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     G5S_0249 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     G5S_0249 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(263570..265447)
Genome map
AA seq 625 aa AA seqDB search
MGNRRVIVVGGGLAGLAAAIQLADRGVLVELVSLTKVKRSHSVCAQGGINAALNLKSEEE
DSPYIHAYDTIKGGDFLADQPPVLEMCLTAPRIIRMLANFGCPFNRSASGDLDVRRFGGT
LYHRTVFCGASTGQQLMYTLDEQVRRRESAGKIIKRENHEFLRLVTNAEGRACGIILMNL
FNNRLEVLKGDAVIVATGGPGVIFKMSTNSTFCTGAANGRLFLQGMTYANPEFIQIHPTA
IPGRDKLRLISESVRGEGGRVWVPGDASKKILFPDGSERPCGKSGEPWYFLEEMYPAYGN
LVSRDVGARAILQVCEAGLGVDGKMEVFLDVTHLPKETLHKLEVVLDIYKKFTGDDPVTT
PMRIFPAVHYSMGGAWVDWPAADDPDREGRFRQMTNLPGCFNCGESDFQYHGANRLGANS
LLSCIFAGLVAGDEAARYIEVFGPALGSSRVYEEALHIEKEENAKILSRKGKENIFVLHE
EIAAIMVRNVTVKRNNHDLQKTLEHLKEFRERLSRVSVHDSSKFANKSFHFIRQMRPMLE
LSLAITKGALLRNEFRGSHYKPEFPKRDDEHWLKTTLASYHPEEPEITYCPVDTRHVAPS
LRDYTKSSTGKIVLDNLPKNIRLPI
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatcgtagagttattgttgtcggtggaggattggcagggttggctgcagcaatt
cagctggcagatcgtggtgttcttgtagagcttgtttctctcacaaaagtaaagcgttcc
cattctgtgtgtgctcagggagggattaacgcagcactcaatctcaagtcagaagaggaa
gactctccctatatacatgcttacgatacaataaaaggaggggatttccttgcagatcaa
cctcctgttttggagatgtgcctcacagctccaaggattatccgcatgttggcgaacttt
ggctgtccctttaatcgtagtgcttctggggatttagatgtccgtaggtttggagggact
ttatatcaccgtacagtcttttgtggtgcctctacgggccagcagctgatgtatacctta
gatgaacaagtgcgcaggagagaaagtgcagggaaaatcataaaaagagaaaaccatgag
tttcttcgtcttgtgactaatgccgagggaagggcttgtgggatcatcttgatgaacctg
tttaacaaccgcttagaggtgcttaagggagacgctgtgattgttgctacaggaggacct
ggagttatctttaagatgtctacgaactccacgttttgtacaggtgcagcgaacgggagg
ctctttttacaaggcatgacttatgcaaaccctgagtttattcagattcatcctacagct
atccctggtcgggataagcttcggttaatctctgagtcggttcgtggagaaggagggcgc
gtgtgggtccctggagatgcttctaagaagatcctcttccctgatggctcagaaagacca
tgtggaaagagtggagagccttggtatttccttgaggagatgtatccagcttatgggaac
ctcgtcagtagagacgttggagcacgggcgattttgcaagtttgcgaggccggattaggc
gtggatggcaaaatggaggtctttttggatgtgacgcatttgcctaaagaaactctgcac
aaactagaagtcgttttagatatttataagaagtttacaggtgacgatcccgtcacaact
cctatgaggattttccctgcggtacattattcgatgggaggggcttgggtagattggcct
gctgctgatgatcctgatcgagaagggcggttccgacagatgactaatctcccaggttgt
tttaactgtggggagtctgatttccaatatcatggagcgaatcgtctaggggcgaattct
ttattatcatgtatttttgctgggcttgttgctggagatgaagctgcacgctatatagag
gtgtttggtcctgctttagggagctctagagtatatgaagaggctttacatatagagaaa
gaagaaaatgccaagatcctttcgagaaaaggaaaggaaaatatctttgtattacacgag
gaaattgccgctataatggtgcggaacgtgacagtaaagcgtaataaccatgatcttcaa
aaaactttagagcatcttaaggagtttcgtgagaggctttctcgtgtttctgttcatgac
tcttcgaagtttgcaaacaagtcttttcatttcatccgtcagatgcggccgatgttagag
ctttctttagcgattaccaagggagctctcttgcgtaatgaatttcgaggttcccattat
aagccggagttccctaagcgtgatgatgaacattggctaaaaacgaccttagcgtcttat
catcctgaagagcctgagattacctattgtccagtggatacacgccatgtcgctccctct
ttgagggactacactaaatcttcaacaggaaagattgttttagacaaccttcccaaaaac
attcgcctgcccatataa

DBGET integrated database retrieval system