KEGG   Chlamydia pecorum E58: G5S_0298Help
Entry
G5S_0298          CDS       T01466                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cpm  Chlamydia pecorum E58
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cpm00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
306156..307193
Genome map
AA seq 345 aa AA seqDB search
MRILDLPRRPRRNRKTAAIRELVAETALLPQDFICPFFIKDGNNVQEEVPSLPGVYRWSI
DLLLKEIERLCRYGLRAVMLFPVVPSELKDAYGSYSSNPKNILCRGISQVKKRFPDLCVI
SDIALDPYTTHGHDGILSSEGEILNDESVHILGNIATLHAEMGADIVAPSDMMDGRIAYI
RSKLDQVGFVQTLILSYSVKYASSLYHPFRDALSSHAQGDKQSYQMNPKNVLEALLESSL
DEKEGADMLMVKPAGLYLDVLFRVRSQSKLPIVAYQVSGEYAMILAASHRGWVQKDAVLM
EALVGIKRAGADMIVSYATPKVLKHLYEEREFFREPHVEKRSQIL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattttagatctcccccgaagacccagaagaaacaggaaaaccgcagcaatacga
gagcttgtagctgaaactgctcttttgcctcaggattttatttgtccatttttcattaag
gatggaaacaatgttcaggaagaagttcccagtttgcctggagtatatcgatggagcatt
gatctccttttaaaagaaatagaaaggctttgtagatatggtcttagagctgtgatgctg
tttcctgtagttcctagcgagcttaaggatgcctacggttcttattcttcaaatcctaaa
aatattttgtgtcgtgggatcagccaggttaaaaaaaggttcccagatctttgtgtaatt
agtgatatcgctttagatccatatactactcatggacatgatggtatactctcgtcagag
ggagagatccttaatgacgagagtgtgcatattttgggaaatattgctactttgcatgca
gagatgggagcggatatagtggctcctagcgatatgatggacggaagaattgcctacatt
cgctctaagttagatcaagtgggatttgtgcagaccttaattctttcgtatagtgtgaag
tatgcttcttctttatatcatccttttcgagatgcgctgtcttctcatgctcagggagat
aaacagagctatcagatgaaccccaaaaatgttttagaggctttgttagagagctcttta
gacgagaaggaaggtgcagatatgttaatggtaaagcctgcagggctttatttagatgtg
ctctttcgtgtgagaagtcagtcaaagcttcctatagttgcttatcaagtcagtggagaa
tacgccatgattttagccgcatcacatagggggtgggtgcaaaaagatgcggttcttatg
gaggctttagttggcatcaaacgcgcgggcgcggacatgattgttagctatgctacaccc
aaggttttaaagcatctttatgaagaacgagagttcttcagagaacctcatgttgagaaa
agatcccagattctttag

DBGET integrated database retrieval system