KEGG   Chlamydia pecorum E58: G5S_0542Help
Entry
G5S_0542          CDS       T01466                                 

Definition
2-oxo acid dehydrogenase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cpm  Chlamydia pecorum E58
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:cpm01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cpm00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:cpm00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
531005..532162
Genome map
AA seq 385 aa AA seqDB search
MFEFRFPKIGEAGSGGSVVRWLKNVGEFVKKDEPLLEVSTDKIATELASPQAGILAQQLV
NEGDEVASGDVLALLEESSLEASEEAPPKEELCTFGEELPTATPGGWFSPSVLSLAQCKG
IAMHELQQIPGTGSDGRVTKKDLEAYIETRSSEDQSKENRIPMSPLRRAIASSLSKSSDE
VPHASLVVDVDVTDLMNLIAEERERFFATHHVKLTITSFIVQCLAKTLEQFPLLNGSLDG
HTIVVKKSINVGVAVNLNKEGVVVPVIRNCQDQGLVSIAKALADLSSRARENRLDPSEVQ
EGSVTVTNFGMTGALMGMPIIRYPEVAILGIGTIQKRVVVREDDSLAIRKMMYVTLTFDH
RVLDGIYGSEFLTSLKNRLESVTMS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagtttcgattccctaaaataggagaagctgggtctggaggatctgtagttcgt
tggctaaagaatgttggagagttcgtcaaaaaagatgagcctctacttgaggtgtcgact
gataaaatcgctacagaacttgcttctcctcaagcgggaatcttagctcagcaacttgtt
aatgaaggagatgaggttgcttctggggatgttttagctttgttagaggaatcttctttg
gaagcatctgaagaagcccctcctaaggaggagctttgtacctttggagaagagcttcct
acagcaactccagggggatggttttcaccttcggtgttaagtttagctcaatgtaaaggg
atcgctatgcatgagctgcagcagatcccaggaacgggaagtgatgggagagtcacgaag
aaggatttagaggcgtatattgaaacccgttcttcggaagatcaaagtaaagagaatcgc
attccgatgtctcctttacgtcgtgctattgcctcttctttgtcgaagtcctcagatgag
gttccccatgcttccttagttgtagacgtagatgttacggatcttatgaatttaattgct
gaggagagagaacgtttttttgctacccatcatgtgaagctgaccattacgagcttcatt
gtgcagtgtcttgcaaagactttagagcagtttcccttattgaatgggtctttagatggc
catactattgtagtaaagaaatccataaatgtgggtgttgctgtaaacctcaacaaggaa
ggagttgttgtccctgtcatccgcaactgccaagatcagggattagtaagtattgctaag
gcccttgcagatctttcctctcgtgctcgagagaatcgcttagatccctctgaagtgcag
gaggggagcgtcacagtcactaattttggcatgacaggagcattgatggggatgccgatt
attcgttatcctgaggtggctattttagggataggcactatccaaaagcgtgtagtggtc
cgagaggatgactctcttgcgattagaaaaatgatgtacgttacacttacttttgatcat
cgtgttcttgatggcatatatggaagcgaatttttaacctcattgaaaaatcgtttagag
tctgttaccatgagctaa

DBGET integrated database retrieval system