KEGG   Chlamydia pecorum E58: G5S_0542Help
Entry
G5S_0542          CDS       T01466                                 

Definition
2-oxo acid dehydrogenase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cpm  Chlamydia pecorum E58
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cpm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    G5S_0542
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    G5S_0542
  Amino acid metabolism
   00310 Lysine degradation
    G5S_0542
Enzymes [BR:cpm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     G5S_0542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
531005..532162
Genome map
AA seq 385 aa AA seqDB search
MFEFRFPKIGEAGSGGSVVRWLKNVGEFVKKDEPLLEVSTDKIATELASPQAGILAQQLV
NEGDEVASGDVLALLEESSLEASEEAPPKEELCTFGEELPTATPGGWFSPSVLSLAQCKG
IAMHELQQIPGTGSDGRVTKKDLEAYIETRSSEDQSKENRIPMSPLRRAIASSLSKSSDE
VPHASLVVDVDVTDLMNLIAEERERFFATHHVKLTITSFIVQCLAKTLEQFPLLNGSLDG
HTIVVKKSINVGVAVNLNKEGVVVPVIRNCQDQGLVSIAKALADLSSRARENRLDPSEVQ
EGSVTVTNFGMTGALMGMPIIRYPEVAILGIGTIQKRVVVREDDSLAIRKMMYVTLTFDH
RVLDGIYGSEFLTSLKNRLESVTMS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagtttcgattccctaaaataggagaagctgggtctggaggatctgtagttcgt
tggctaaagaatgttggagagttcgtcaaaaaagatgagcctctacttgaggtgtcgact
gataaaatcgctacagaacttgcttctcctcaagcgggaatcttagctcagcaacttgtt
aatgaaggagatgaggttgcttctggggatgttttagctttgttagaggaatcttctttg
gaagcatctgaagaagcccctcctaaggaggagctttgtacctttggagaagagcttcct
acagcaactccagggggatggttttcaccttcggtgttaagtttagctcaatgtaaaggg
atcgctatgcatgagctgcagcagatcccaggaacgggaagtgatgggagagtcacgaag
aaggatttagaggcgtatattgaaacccgttcttcggaagatcaaagtaaagagaatcgc
attccgatgtctcctttacgtcgtgctattgcctcttctttgtcgaagtcctcagatgag
gttccccatgcttccttagttgtagacgtagatgttacggatcttatgaatttaattgct
gaggagagagaacgtttttttgctacccatcatgtgaagctgaccattacgagcttcatt
gtgcagtgtcttgcaaagactttagagcagtttcccttattgaatgggtctttagatggc
catactattgtagtaaagaaatccataaatgtgggtgttgctgtaaacctcaacaaggaa
ggagttgttgtccctgtcatccgcaactgccaagatcagggattagtaagtattgctaag
gcccttgcagatctttcctctcgtgctcgagagaatcgcttagatccctctgaagtgcag
gaggggagcgtcacagtcactaattttggcatgacaggagcattgatggggatgccgatt
attcgttatcctgaggtggctattttagggataggcactatccaaaagcgtgtagtggtc
cgagaggatgactctcttgcgattagaaaaatgatgtacgttacacttacttttgatcat
cgtgttcttgatggcatatatggaagcgaatttttaacctcattgaaaaatcgtttagag
tctgttaccatgagctaa

DBGET integrated database retrieval system