KEGG   Chlamydia pecorum E58: G5S_0651Help
Entry
G5S_0651          CDS       T01466                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cpm  Chlamydia pecorum E58
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cpm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    G5S_0651 (tpiA)
   01230 Biosynthesis of amino acids
    G5S_0651 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    G5S_0651 (tpiA)
   00051 Fructose and mannose metabolism
    G5S_0651 (tpiA)
   00562 Inositol phosphate metabolism
    G5S_0651 (tpiA)
Enzymes [BR:cpm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     G5S_0651 (tpiA)
Exosome [BR:cpm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   G5S_0651 (tpiA)
  Exosomal proteins of bladder cancer cells
   G5S_0651 (tpiA)
  Exosomal proteins of melanoma cells
   G5S_0651 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
649565..650344
Genome map
AA seq 259 aa AA seqDB search
MVRERYVLGNWKMHKTCQSAEEYMTTLCPLLKKEEPPCHVGIAAPFTALQCCSLQIEKFH
STLKLGAQNVFQEPEGAFTGEISLAMLKEFYTSFVLLGHSERRQKFHEDNAIIAAKMQAV
ANSGLLPVLCIGESLETKEKGETYPYLEEQLMSGLEKFPKDAEVVLAYEPIWAIGTGRVA
EAGEVQEIHEFCRRILARIFSEEKATEISILYGGSVKADNAALFGKCHDVDGLLVGGASL
KPTEFFEVIKNFCSADSAC
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggttcgtgagcgctacgttttagggaattggaaaatgcataagacatgtcagagtgcg
gaagaatacatgacgactctttgtcctttattaaaaaaggaagagcctccttgtcatgtg
ggcatagctgcacctttcactgcactccaatgctgttctctgcaaatagaaaagtttcat
tctactcttaagttgggagctcaaaatgtttttcaagagccagaaggggcatttactgga
gagatttccctagccatgctaaaggagttttatacttcttttgtattgcttggccactcg
gagcgtcgacagaagtttcatgaagacaatgctattatcgctgccaaaatgcaggctgtt
gcgaactccgggcttcttcctgtattgtgtatcggagaaagtttggaaaccaaagaaaag
ggggagacatatccttatttggaagagcagctgatgtcaggattagaaaagttccccaaa
gatgctgaggttgtgcttgcatatgaacctatttgggcgatcggaacaggaagagttgct
gaagcaggtgaggtgcaggagattcatgagttttgtaggcgtatattagcaagaatcttt
tctgaggaaaaggctacagagatttcgattctttatgggggatccgtaaaagctgacaat
gccgcacttttcgggaaatgccatgatgttgatggtttgttggttggcggagcttcctta
aaacctacagagttttttgaggtgatcaaaaacttctgcagtgcagattctgcatgttga

DBGET integrated database retrieval system