KEGG   Chlamydia pecorum E58: G5S_0724Help
Entry
G5S_0724          CDS       T01466                                 

Definition
DNA polymerase III subunit epsilon (EC:2.7.7.7)
Orthology
K02342  
DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
cpm  Chlamydia pecorum E58
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    G5S_0724
   00240 Pyrimidine metabolism
    G5S_0724
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    G5S_0724
   03430 Mismatch repair
    G5S_0724
   03440 Homologous recombination
    G5S_0724
Enzymes [BR:cpm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     G5S_0724
DNA replication proteins [BR:cpm03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     G5S_0724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(717937..718635)
Genome map
AA seq 232 aa AA seqDB search
MSVLIFYDTETTGTQIDKDRVIEIAAYNSSTKESFVTYVNPEIPVPEDSSKIHGITTAMV
SSAPTFPEAYHNFKQFCGSASILVAHNNDNFDLPLLQKECQRYSLEPLNLRTIDSLKWAK
KYRPDLPKHNLQYLRQVYGFAENQAHRALDDVITLHKVFSALVGDLTPEQILALLEESFH
PRVFKMPFGKYKGKTLSEIPASYLEWLENQGALDKPENQDMKAAIALLKQPV
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtattgattttttatgacaccgaaactacaggaacgcaaattgataaagatcga
gtgatagaaattgctgcctacaatagctccacaaaagaatcttttgtcacttatgtaaat
cctgagattcccgttcctgaagattcttctaaaattcatgggattaccactgcaatggta
tcttctgcaccgacttttcctgaagcctaccataattttaagcagttctgtggcagtgca
agcattcttgtcgctcataacaatgataacttcgaccttcctctgcttcaaaaagagtgc
caaagatattccttagagccactaaacttgcgcacaatagattccctaaagtgggcaaaa
aaatatcgcccagatcttcctaagcataacctacagtatttacgacaagtctatggcttt
gcagaaaaccaagcccatagagctctagatgacgttattacgctacacaaggtcttttct
gctttagtcggagacctaacccccgagcagattctagctcttctagaagagagcttccat
cctagagtctttaaaatgccctttgggaaatacaaagggaagacgctatcagagatccct
gcctcttacttagagtggcttgaaaatcaaggtgctctcgacaaacctgaaaatcaagat
atgaaagctgcgattgccctactgaagcaacctgtatga

DBGET integrated database retrieval system