KEGG   Chlamydia pecorum E58: G5S_0762Help
Entry
G5S_0762          CDS       T01466                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cpm  Chlamydia pecorum E58
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cpm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    G5S_0762 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    G5S_0762 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    G5S_0762 (sucB)
Enzymes [BR:cpm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     G5S_0762 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
750918..751994
Genome map
AA seq 358 aa AA seqDB search
MITEVRIPNIAESISEVTIASLLVSSGSIIQENQGILEIESDKLNQLIYAPISGKISWKV
SEGDVVAVGGLVATIEETQESSETLEILEREPVEAEIIRFPSDQKPPYQGKRFVPLKEKK
SLRDTSERGEIRERMSSIRKTISRRLVSSLHESAMLTTFNEIYMTPCIQLRKEKQERFME
KFGVKLGYMSFFVKAVLEGLKAYPRLHAYISGEEIVYRQYYDICLAIGTDRGLVAPVIRD
CQQLSSGEIEQKLADLAIRAREGQLSLAELEGGGFTITNGGVYGSLLSTPILNPPQVGIL
GMHKIEKRPVVLDGEIVIADMMYVALSYDHRIIDGKEAVGFLVKVKESIEHPEALLEL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgattacagaggttcgcattccaaatattgcagaatcaattagtgaagtcacgatcgca
tcactactggtctcttcgggaagcattattcaggaaaaccaaggtattcttgaaatcgaa
agtgataaactaaaccagttaatttacgcccctatctcagggaagatttcctggaaagtc
tctgaaggagacgttgttgctgttggaggtctggttgctaccatagaggagacacaagag
agttcagaaactctcgagatccttgagcgtgaacctgtagaagcagaaattatccgcttc
ccttcagatcaaaagccgccctatcaggggaaacgctttgttccacttaaggaaaaaaaa
tctctaagagatacttcggagcgtggggagatccgagagaggatgtcttctatccgtaaa
acgatttctcggcgtctggtctcttctctgcatgaatctgctatgttgacgactttcaat
gaaatctacatgaccccatgtattcagctaagaaaagagaagcaagagcgtttcatggag
aaattcggcgtaaagttaggctatatgtcgtttttcgttaaagcagtcttggaagggcta
aaggcttatcctagattacatgcttatattagcggagaggaaattgtttatcgtcagtat
tacgatatctgcctagcgattgggacagaccgaggtttagttgctcctgttatccgtgat
tgccagcagctctctagtggcgagatcgaacaaaaacttgcagatctcgccataagagct
agagaagggcagctttcccttgcagaacttgaaggcggaggattcacaattaccaatggg
ggagtctatggctccttactctctacgcctatccttaatcctcctcaagtaggaatccta
gggatgcataaaatagaaaaacgtccggtagtgctcgacggagagattgtgattgcagat
atgatgtatgtcgccttaagttatgatcatcgaattatcgatggaaaagaagccgtaggt
ttccttgttaaggtgaaagaaagcatagaacatcccgaggctcttttagagctctag

DBGET integrated database retrieval system