KEGG   Chlamydia pecorum E58: G5S_0808Help
Entry
G5S_0808          CDS       T01466                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cpm  Chlamydia pecorum E58
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    G5S_0808 (malQ)
Enzymes [BR:cpm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     G5S_0808 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(790747..791988)
Genome map
AA seq 413 aa AA seqDB search
MHKLCALPHVPYPKVKQAKWEFLREYYTQIGKASSADNPEFHKFIDKESSWLSPYALFRA
IKHHMNGTPSTTWPISLTDQKQFPQLAKTFSSEIHFFSYLQFLCYQQLSQVRTFADQHQV
FLMGDLPILISKDSCDVWYAKEYFSSSGSVGAPPDFYNAEGQNWQLPIYNIENLKKDNYI
WWKERLRYAENFYSLYRLDHIVGFFRLWVWDSQGNGKFFPESPKEYLKQGTEILSSLLQD
SSMLPIGEDLGDVPKDIKKRLKTLGICGTRIPRWEKYWESGEGFIPFDKYCPLSMTSLST
HDSDTLALWWNNSPSEAKEFASFLNLPYSSKLTVETQKTILNLSHQTASIFHINLLNDYL
ALCPELISKQLYQERINVPGTLSHTNWIYRVRPSIEELSSHERFNHYIKEILP
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgcataaactctgtgccttacctcatgttccctatcctaaagtaaaacaggcaaaatgg
gagtttcttagggaatattatacccaaataggaaaagcctctagtgctgacaatccagag
ttccataagtttatagataaagagtcctcctggctctctccctatgcactgtttcgagca
atcaaacaccatatgaatgggactccaagcacaacatggcccatctcattgacagatcaa
aaacagtttcctcaattagcaaaaaccttttcctctgagatacattttttttcttatcta
cagtttctctgttaccaacaactctcccaggtacgtacctttgctgatcaacaccaagtc
tttcttatgggagatcttcctattttaatcagtaaggatagctgcgatgtgtggtatgct
aaggagtatttctcttcatcaggatctgtaggtgcccctccagatttttacaacgccgaa
gggcaaaactggcagctgcctatctacaacatagaaaatcttaaaaaagataactatatc
tggtggaaggagcgcttacgctacgcagaaaacttttattctctataccgtcttgatcat
attgtaggattctttcgcttatgggtatgggactctcaaggaaacgggaagttcttccca
gaatctcctaaagaatacctaaagcagggaaccgaaatcctctcttctttacttcaagat
tcctccatgctccctattggtgaggatcttggagatgtccctaaagatatcaaaaagagg
ctaaaaactttgggaatttgtggaacacgcattcctagatgggagaagtactgggaatct
ggagaaggatttattccctttgataagtattgtcctctatccatgacttccttatccacg
catgattccgataccttagcactgtggtggaataactccccctcagaagcaaaagagttt
gcctcgttcttaaatctcccctattcttccaaactaactgtagaaactcaaaaaacaatt
ttaaatctgtctcaccaaactgcttcaatttttcatatcaacctactcaatgactacttg
gctctctgtccagagctaatctcaaagcagctataccaagaaagaattaacgtcccagga
actctatcccatactaactggatatatagagtacgcccatctatagaagagctttcctct
cacgaacgttttaatcactatataaaagaaatacttccataa

DBGET integrated database retrieval system