KEGG   Chlamydia pecorum E58: G5S_0983Help
Entry
G5S_0983          CDS       T01466                                 

Definition
fructose-6-P phosphotransferase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cpm  Chlamydia pecorum E58
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cpm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    G5S_0983
   01230 Biosynthesis of amino acids
    G5S_0983
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    G5S_0983
   00030 Pentose phosphate pathway
    G5S_0983
   00051 Fructose and mannose metabolism
    G5S_0983
   00052 Galactose metabolism
    G5S_0983
  Energy metabolism
   00680 Methane metabolism
    G5S_0983
Enzymes [BR:cpm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     G5S_0983
Protein phosphatases and associated proteins [BR:cpm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     G5S_0983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
964974..966629
Genome map
AA seq 551 aa AA seqDB search
MHPSYIDLDTIINSYTPPLPKELQKAEILTPHPDKGKSHKISKDIKTLFPHTCDLPYIRF
SPGKPSPAGPLKVGVMLSGGPAPGGHNVIQGLLDSLKKFHQNSQLIGFLNDGEGLTNNNA
INITKEFLYKFRNSGGFNCLGTGRKNIVSQEGKESCLKTIRAQDLDGLVIIGGDGSNTAT
AILAEYLAKEHPKTSVVGVPKTIDGDLQHDLLDLTFGFDTATKFYSSIISNISRDALSCK
AHYHFIKLMGRSASHITLECALQTHPNIALIGEEIAAKNLPLKTIIHKICSIIADRAAME
KYYGVILIPEGIIEFIPEITNLIREIEALSETQEKLSQLSPESQELIHSFPPKIIDQLLY
DRDAHGNVYVSKISVEKLLIHLVKNHLQKHFKTVPFNAVSHFLGYEGRSGIPTKFDNDYG
YSLGFGAGVLVRHCCNGYLSTIESLACSFEKWRLRAIPIVKMLTLKRHSDSPLQPKIKKH
LVDISSPSFKKFKLYRKIWALEDSYRFLGPLQLQTPPDTHSDNFPPLTLLLNHNHWQHQC
HMCIEIPDGNY
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgcatccatcttacatagatcttgatacgataatcaactcatacaccccgcctctcccc
aaagaactccagaaagcagaaatacttactccccaccctgacaaaggaaaatctcataag
atttccaaagatatcaaaacattattcccccatacctgcgatcttccctacatcagattc
tctcctgggaagccttctccagcagggcccctaaaagtgggggtaatgctctcaggaggc
cccgcacccggagggcacaacgtcattcaaggattactagacagcctaaagaagtttcac
caaaactctcaactcataggatttttaaatgatggtgagggactaacaaacaataacgct
ataaacatcacaaaagaattcctctataagttccgaaactctggaggatttaactgttta
ggcacaggaagaaaaaacatcgtctcgcaagagggaaaagagagttgtctcaaaaccata
cgtgctcaagatctcgatgggctggtcatcattggaggggacggctcaaatacggcaaca
gcaatccttgcagagtatcttgcaaaagaacacccaaaaacttcagtagtaggagtgcca
aaaactatagatggcgacttgcaacatgacctcttagaccttacatttggctttgatact
gccacaaaattctattcttcaatcattagcaatatctctagagacgctctctcttgtaag
gcacactaccacttcatcaagctcatgggacgctcagcatcacacattactttagaatgt
gccttacaaacccatccaaatattgcccttattggagaggagattgcagcgaagaacctc
cctctaaaaacgattatacataaaatctgctccataattgcagatcgcgctgctatggaa
aaatactatggtgtaattcttatccctgaagggatcatcgagtttatcccagaaattacc
aatctcattagggaaatcgaagccctctcagaaacccaagaaaagctctctcagctctct
ccagaatctcaagagctcatccacagcttccctccaaaaattattgaccagcttctctat
gatcgcgatgctcacggaaatgtctacgtctctaaaatcagtgtagagaaactcctcatt
caccttgtgaaaaatcacctccaaaaacatttcaaaaccgtccctttcaatgcagtatca
cactttctaggctacgaaggaagatccggaatccctacaaagttcgataacgattacggc
tacagcttaggattcggtgctggagttttagttcgccattgctgcaatggttacctctct
acaatagaatccctcgcctgttcttttgagaagtggcgtctacgggcaattcccattgtg
aagatgctcacactaaaacgtcattctgatagccccctgcagcccaagatcaaaaaacat
ttggttgatattagtagtccttcatttaaaaagttcaagctatacagaaaaatctgggcc
ttagaagactcctacagatttttagggccactacaactacaaacccctccagatacccat
tctgataacttccctccacttacccttcttttaaaccacaaccactggcaacaccaatgt
cacatgtgtatagaaatccctgatggaaattattag

DBGET integrated database retrieval system