KEGG   Chlamydia pecorum E58: G5S_1023Help
Entry
G5S_1023          CDS       T01466                                 

Definition
RecD/TraA family helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cpm  Chlamydia pecorum E58
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    G5S_1023
Enzymes [BR:cpm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     G5S_1023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1005498..1007723
Genome map
AA seq 741 aa AA seqDB search
MEKIYGNIERILVEDPQSGDLTAHVKIPHKEEVVLVRGQLPQVFQQLGTLLHLYGEWCQT
PNLGKYFQIEKYDLPKPYETRGVFNYLTSKLIKGIGPKLATKIIETFQTETLNVLDLTPE
RLIEVPGISKARVESLCQQLHEQRTLRSTLLFLQQYNIAIHYGVRIFKKYQEKSIEKICE
DPFLLAREIEGIGFKTADFIAMRLGIPPNSRSRLCAGIQHCLEELQEEGHTCYPIQALAE
IVTKLLNQDLPTKLIHHEDILAQISQMQESKSLCVHEIDGILHVWTRYLYLAEHTIAGDL
KRILYSSRKIRPIDGDKAIAWVEENLNLNLALKQKEAVKACFSEKLHIITGGPGTGKSTI
TQAILKIFEQVTYKIILTAPTGKATKRMTEITHKHSVTIHTLLQYDFKTKSFRKNSDNPI
DCDLIIVDESGMMDTYLLYHLLKALPDHAILILIGDVHQLPSIGPGHILKDLINSHKISV
TELNEIFRQVHNSGIIINAHRVNEGEFPMLYSESGRKDFLFFQKEDPQEALEHILFLTTQ
FVPKKYHIYPKDIQILAPMKKGILGIHNLNKELKAALNPQKTHFQGKLHSYAIGDKVMQI
RNNYNKEVFNGDIGYISELNFKDRRLVVKMEERYVSYSFTELDDLVLAYATSVHKYQGSE
SPCIIIPIHTSHFMMLYRNLLYTAITRGKQLVILVGTKKAIAIATKNNKVQHRCTGLVKA
LNILDTPKDIEEYQEDLDTAF
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaatctacggcaacatagagcgaatcttagttgaagatccacaatctggggat
cttaccgcacatgtgaaaatccctcataaggaagaggttgttcttgttagagggcaactc
cctcaagtttttcagcagctgggaactcttttacatctttatggggagtggtgccaaaca
ccaaatcttggaaaatacttccaaattgaaaagtatgatcttcctaagccctatgaaact
cggggagtatttaattacctgacctccaagcttatcaaggggatcggtccaaaactagcg
acaaaaatcattgaaaccttccaaacggaaaccctaaatgtcctagacctcactccagaa
cgccttattgaagtccccggaattagcaaagcccgcgtagagagcctatgtcaacaactc
catgaacaaagaacacttagatctacactgctctttctacagcaatacaatattgctatc
cactatggcgtcaggatctttaagaaatatcaagagaaatctatagaaaagatctgcgag
gatcccttccttcttgctcgggagatcgaaggaataggctttaaaactgcagactttatc
gccatgcgtttgggtattcctccaaattcccgtagtcgtttatgtgcaggaatacaacac
tgcttagaagaacttcaggaagaaggccatacctgctatcccattcaggcgcttgcggag
attgttacaaagcttctaaaccaagatctcccaacaaagcttatccatcatgaggatatc
cttgcacaaatctctcagatgcaagaaagcaagtctttatgtgtccatgagattgatggg
atccttcatgtatggacacgctacctctatcttgcagaacacacaattgctggggattta
aaaaggatcctttattcttcaagaaagatccgccctatagatggagataaagccatagct
tgggtagaggaaaaccttaatcttaacttggctctaaaacaaaaagaagctgttaaggcg
tgtttttcagagaagctccacatcatcactggagggccaggaactggaaaaagtactatt
acccaggcgatcttaaaaatctttgagcaggtcacttataagatcattcttacagctcct
acagggaaagctacaaagcgcatgacggaaatcacacataagcactctgtgactatccac
accctgctgcaatatgatttcaagaccaaatccttccgcaagaatagtgacaaccctata
gattgcgatcttattatcgtagatgaatctggaatgatggatacctatcttctctatcac
ctcctcaaagctcttccagatcatgctattcttattctcatcggtgatgtacatcagctt
cccagtattgggcctgggcatatccttaaagacctcattaactcccataaaattagcgtc
accgagctcaatgagattttccgtcaggtgcataactctggaattattatcaatgcccac
agagtaaatgaaggagagtttcccatgctctattcggaatctgggcggaaagatttttta
tttttccaaaaggaagatcctcaggaagccttagagcatatactgttccttaccacgcaa
tttgtcccaaagaagtaccatatctatcctaaggatatccaaattctcgctccgatgaaa
aaagggatcttaggaatccacaacctcaacaaagagcttaaggctgcgttaaatcctcaa
aaaacgcactttcaagggaagttgcactcttatgctattggggacaaagtgatgcaaatc
cgcaataactataataaagaagtcttcaatggagatattggctacatctcagagctcaat
ttcaaagacaggagacttgtcgtgaaaatggaagaaagatatgtctcctattcttttaca
gaattggatgatcttgttttagcatatgccacttccgtacacaaataccaaggaagcgaa
agtccctgtattatcatccctattcatacttcacatttcatgatgctctaccgcaatctc
ctttatactgcgatcacaaggggaaaacaactcgtcattcttgttgggacaaaaaaagcc
attgcgatcgcaacaaaaaacaacaaagtacaacaccgctgcacgggacttgtcaaagca
ttaaacatcctagacacccctaaagacatagaagaatatcaagaggatctcgacacagca
ttttaa

DBGET integrated database retrieval system