KEGG   Chlamydia pecorum E58: G5S_1027Help
Entry
G5S_1027          CDS       T01466                                 

Gene name
gmk
Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cpm  Chlamydia pecorum E58
Pathway
cpm00230  Purine metabolism
cpm01100  Metabolic pathways
Module
cpm_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cpm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    G5S_1027 (gmk)
Enzymes [BR:cpm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     G5S_1027 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_22 dNK AAA_16 Rad17 MMR_HSR1 AAA_30 Zeta_toxin Cytidylate_kin AAA_23 Cytidylate_kin2 ABC_tran AAA cobW
Motif
Other DBs
NCBI-ProteinID: AEB41944
Position
complement(1009735..1010349)
Genome map
AA seq 204 aa AA seqDB search
MNTQLLHPFSQDSKSYSPKLFTISAPAGSGKTTLVKMLEQEFPYSFQKTLSMTTRKPRKG
EVSGEDYLFVSSEEFQELVAKGAFLEWIFLFGEYYGTTRLEIERIWALGKHAIAVIDVQG
AMAIRQKMPSVSIFIAPPSKEELERRLDKRGSEEVLQRKERLEHSTKELAMVNQFDYVIV
NDHLELAYRILKSIFIAEEHRNNL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgcaactcctccatcctttttctcaagattctaaatcctactcgccaaaactt
tttactatcagtgcgcctgctggttcggggaaaacaaccttagtaaaaatgttggaacaa
gaatttccatattcttttcagaagactttatcgatgacaacaaggaaaccccgaaaagga
gaagtctctggagaggactatctttttgtttcgagtgaggagtttcaagagcttgtagct
aaaggggcttttcttgaatggatctttttatttggagaatattacggtaccacaaggtta
gagatagaaagaatctgggctttggggaagcatgcgattgcagtaattgatgttcaaggg
gctatggcaattcgccaaaaaatgcctagtgtgtcaatatttattgcccccccgtctaag
gaggagttagaacgccgcttggataaacgtggttccgaagaggttctgcaaaggaaagag
cggctagagcatagcacgaaagaacttgctatggtgaatcagtttgattatgtcattgta
aatgatcacttagagctagcgtatcggattttaaagagtatttttatagctgaggaacac
aggaataatttatga

DBGET integrated database retrieval system