KEGG   Chlamydia pecorum E58: G5S_1083Help
Entry
G5S_1083          CDS       T01466                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cpm  Chlamydia pecorum E58
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cpm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    G5S_1083 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    G5S_1083 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    G5S_1083 (trpA)
Enzymes [BR:cpm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     G5S_1083 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1074207..1074974)
Genome map
AA seq 255 aa AA seqDB search
MHRIDETFKNKKPFIGYLTGGDGGLDYSVACAQALIRGGVDILEIGFPFSDPVADGPVIQ
KAHERALENRANSTMILEIARRIRESSEVPLVLFSYFNPLLQLGKEYLQQLKTVGYDAVL
IVDLPIPFHDEIDPFLLEVLNIGLAPILLATPSSSDQRLSQISTYARGFLYYVSHKGTTG
VRANLAEDFATQISRMRQHFSIPIVSGFGIGDRESAKEALECADGFVVGSAFVEKIGEKT
PLEELTLFARSIDPR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcatagaatagacgagacatttaagaacaagaaaccattcattggatacttaacagga
ggagatggtggactggattatagcgtcgcttgcgcgcaagcgttaattcgtggaggtgtg
gatattttagaaataggatttcctttttctgatcctgttgcagatggtccagtgatacaa
aaagctcatgaaagagctttagaaaaccgagctaactctacaatgattttagagatcgca
aggcgtataagagaaagctccgaagttccacttgtactctttagttatttcaatcctttg
ttgcaattagggaaggaatatctgcaacagttaaaaactgtaggatacgatgctgtgtta
atcgtagacttacctattccttttcatgatgaaatcgacccgttcttgctagaggttctt
aacataggtctagctccaatattattagcgacaccatcgagtagtgatcaacgtttatct
cagattagtacgtatgctcgtggctttctatattatgtctctcataagggaacgacaggg
gtccgagccaatttagcagaggattttgctacgcagatctcaaggatgcgtcagcacttc
tccatccctattgtctctgggtttggcataggagatcgtgaaagtgctaaagaagccttg
gaatgtgcagatggctttgtcgtaggatcggcatttgtcgaaaagattggagagaagacc
cctttagaagaacttacattatttgctcgttctatagatcctcgttag

DBGET integrated database retrieval system