KEGG   Chlamydia pecorum E58: G5S_1084Help
Entry
G5S_1084          CDS       T01466                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cpm  Chlamydia pecorum E58
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cpm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    G5S_1084 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    G5S_1084 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    G5S_1084 (trpB)
Enzymes [BR:cpm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     G5S_1084 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1074967..1076145)
Genome map
AA seq 392 aa AA seqDB search
MKHPYAFGGQFVPEILMGPIQELSNSWETLKEDRGFKEEFDSILKHYAGRPTPLTEVKNF
AKAIDGPRVFLKREDLLHTGAHKINNVIGQCLLAKYLGKTRVIAETGAGQHGVATATACA
YFGLECEIYMGEEDIKRQRPNVDKMEVLGATVISVTQGSASLKEAVNEALRSWAESFEST
HYCLGSALGPSPYPDIVQSFQSVISFEVKAQLQEYTERSPDVLIACVGGGSNAIGFFHHF
IPDERVKLIGVEAGGLGIETGKHAARFAKGRPGVFHGFYSYLLQDEEGQILNTHSISAGM
NYSSVGPVHAEFYESGRASYTTATDKEALEAFSLLSRAEGIIPALESSHALACLIRMAPK
LPKESIVIVNLSGRGDKDLLHVKNLMESGYYA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatccttatgcatttggtggacagtttgttccagaaatcctgatgggtcctatt
caagaattaagtaatagctgggagactttaaaagaggataggggatttaaagaagagttt
gattcgatcttgaagcattatgcaggaaggcccactccacttacggaagtgaaaaatttt
gctaaagcgattgatggacctcgggtgtttttaaaaagagaggatcttctgcacacagga
gcacataaaatcaataatgtcattggccagtgtctactagcaaaatatctcggaaagaca
cgagttattgcggagacaggagcaggacaacatggtgtagctacagcaacggcatgtgcc
tattttgggcttgagtgtgagatctatatgggagaggaagatattaaaagacagcgacct
aatgttgataaaatggaggttttaggcgcaacagtgatttctgtcacccaagggtccgca
tctttgaaagaggccgtaaatgaggctctccggagttgggcggaaagttttgaaagcacg
cattattgcttgggttctgctcttggcccctcgccatatcctgacattgtacaaagtttt
cagtcagttattagctttgaggtaaaggcacagctacaggagtatactgagcgctctcca
gatgttttaattgcatgtgttggagggggatccaatgcgattgggtttttccatcacttc
attcctgatgagagggtaaaattgatcggagtagaagccggaggattaggaatcgaaaca
ggaaaacatgcggcaagatttgctaagggacgtcctggggtatttcatgggttctattct
taccttttgcaggatgaagaaggacaaattttgaatacacattcaatttctgcagggatg
aattattcctctgtaggtcctgtacatgcagaattttatgaatctggaagggcatcttac
actacagcaacagataaggaggctctagaagcattttctttgctatctagggccgaaggg
atcatccctgctttagagtcttcgcatgctttagcatgcttaataaggatggctcctaag
cttcctaaggagagtatcgttattgtgaacttatccggaagaggagataaggatttatta
catgtaaaaaatctaatggaatcaggttattatgcatag

DBGET integrated database retrieval system