KEGG   Chlamydia pneumoniae CWL029: CPn0299Help
Entry
CPn0299           CDS       T00021                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
cpn  Chlamydia pneumoniae CWL029
Pathway
cpn03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CPn0299 (recR)
DNA repair and recombination proteins [BR:cpn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     CPn0299 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CPn0299 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 Toprim RecR HHH_5
Motif
Other DBs
NCBI-GeneID: 895111
NCBI-ProteinID: NP_224504
UniProt: Q9Z8N9
Position
336816..337418
Genome map
AA seq 200 aa AA seqDB search
MTRYPDYLSKLIFFLRKLPGIGFKTAEKLAFELISWDSEQLKILGNAFHNVASERSHCPL
CFTLKESKEADCHFCREERDNQSLCIVASPKDVFFLERSKVFKGRYHVLGSLLSPITGKH
IENERLSILKSRIETLCPKEIILAIDATLEGDATALFLKQELQHFSVNISRLALGLPIGL
SFDYVDSGTLARAFSGRHSY
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgacaagatatccagattacttatctaaattaattttctttttacgaaaacttccagga
attggatttaaaacagcagaaaaacttgcttttgaactcatctcttgggacagcgaacaa
ttaaaaatattaggtaacgcttttcataatgttgctagtgagcgtagtcactgtccccta
tgttttactctcaaagaatctaaagaggcagactgtcacttttgtagagaagaaagagat
aaccaaagtctatgtattgtcgcttctccaaaagatgttttctttctagaacgttctaaa
gtattcaagggacgttatcatgttcttggttcactcttatcgcccattacagggaaacat
atagaaaacgagcgtctctccattttaaaatcacgcatagaaacgctatgcccaaaagaa
attatcctagccattgatgcaaccttagaaggagatgctactgccctttttctaaaacaa
gaattacaacatttctctgtaaatatttcccgtctagctttaggtcttcctataggctta
tcttttgattatgtagattcagggacactggcaagagctttttctggacgacactcctat
tag

DBGET integrated database retrieval system