KEGG   Chlamydia pneumoniae CWL029: CPn0620Help
Entry
CPn0620           CDS       T00021                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cpn  Chlamydia pneumoniae CWL029
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CPn0620 (ruvA)
Enzymes [BR:cpn01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CPn0620 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(713516..714139)
Genome map
AA seq 207 aa AA seqDB search
MYDYIRGTLTYVHTGAIVIECQGIGYHIAITERWAIECIRALHQDFLVFTHVIFRETEHL
LYGFHSREERECFRILISFSGIGPKLALAILNALPLKVLCSVVRSEDIRALASVSGIGKK
TAEKLMVELKQKLPDLLPLDSRVETSQTHTTSSCLEEGIQALAALGYSKIAAERMIAEAI
KDLPEGSSLTDILPIALKKNFSGVNKD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtacgactatattcgtggaacactgacctatgtgcatactggtgcaattgttatagaa
tgccaaggtattggctaccatattgctattacagaacgttgggcaatagaatgcatcagg
gctttacatcaagactttctcgtcttcactcatgtgatattccgtgaaacggaacacttg
ctctatgggtttcattctcgagaagagcgagagtgtttccgtattttaatttctttttct
ggaataggacctaagctagccctcgcgattcttaatgcgctacctttaaaggtactatgt
tctgtagtccgatctgaagatattcgtgctttagcttccgtatcgggaattgggaaaaaa
actgctgaaaaactcatggttgagcttaaacaaaaattaccagatttacttcctctagac
tcgagagtggagaccagccaaacacataccacctcttcttgcttggaggaaggcattcag
gctttagcagctttgggttattcaaaaattgctgctgaacgtatgattgccgaagcaatc
aaagatctccctgagggatcttctttaacagatatccttcctatcgctctgaaaaagaat
ttttcaggagtgaacaaggactag

DBGET integrated database retrieval system