KEGG   Chlamydia pneumoniae CWL029: CPn0744Help
Entry
CPn0744           CDS       T00021                                 

Gene name
hemB
Definition
(RefSeq) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
cpn  Chlamydia pneumoniae CWL029
Pathway
cpn00860  Porphyrin and chlorophyll metabolism
cpn01100  Metabolic pathways
cpn01110  Biosynthesis of secondary metabolites
cpn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cpn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CPn0744 (hemB)
Enzymes [BR:cpn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CPn0744 (hemB)
Exosome [BR:cpn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CPn0744 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-GeneID: 895528
NCBI-ProteinID: NP_224940
UniProt: Q9Z7G1
Position
complement(840386..841384)
Genome map
AA seq 332 aa AA seqDB search
MSSLTLSRRPRRNRKTAAIRDLLAETHLSPKDLIAPFFVKYGNNIKEEIPSLPGVFRWSL
DLLLKEIERLCTYGLRAVMLFPIIPDDLKDAYGSYSSNPKNILCHSIHEIKNAFPHLCLI
SDIALDPYTTHGHDGIFLNGEVLNDESVRIFGNIATLHAEMGADIVAPSDMMDGRIGYIR
SKLDQSGYSKTSIMSYSVKYASCLYSPFRDALSSHVTSGDKKQYQMNPKNVLEALLESSL
DEEEGADILMVKPAGLYLDVIYRIRQNTCLPLAAYQVSGEYAMILSAFQQGWLDKETLFH
ESLIAIKRAGADMIISYSAPFILELLHQGFEF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgagttctttaacactaagtagacgtcctagaagaaaccgaaagacagcagctataaga
gatttgttggccgaaactcacttaagcccaaaagatctcatagcaccattctttgtgaag
tatggaaataacataaaggaagagatcccgagtcttcctggagtgttccgatggagtttg
gatttgctattaaaggaaatagagcgtttgtgtacctacgggttacgagctgtaatgctg
tttcccattattcctgatgatcttaaagatgcttacggttcttactcctcaaatcctaaa
aacatcttatgtcatagcattcatgaaataaaaaacgcatttcctcacctatgtctgatt
agtgatatagctttagatccttatacgacacacggtcatgatgggattttccttaatgga
gaggtccttaatgatgaaagtgttagaatttttggaaatattgcaactttacatgctgaa
atgggagcggatatcgtagctccgagtgatatgatggatggaaggattggctacattcgc
tctaagttagaccagtctggctactcaaagacctctataatgtcttatagtgtaaagtac
gcttcttgtttgtattctccttttcgtgatgcgctgagttctcacgtaacttcaggagat
aaaaaacagtatcagatgaaccctaaaaacgtattagaggcattgcttgaatcttcttta
gacgaggaggagggagcagatatcttaatggtgaagcctgcaggactctatcttgatgtg
atctatcggattcgacaaaatacctgtttgcctctagctgcgtatcaggtcagtggggaa
tacgctatgatcttatcagcctttcaacaaggttggttagataaagaaacactatttcat
gagtctttgatagcaatcaagagagctggcgcagatatgattattagttactccgctcct
tttattttggaattactgcatcagggatttgaattttaa

DBGET integrated database retrieval system