KEGG   Chlamydia pneumoniae CWL029: CPn0933Help
Entry
CPn0933           CDS       T00021                                 

Definition
disulfide bond isomerase
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
cpn  Chlamydia pneumoniae CWL029
Brite
Enzymes [BR:cpn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CPn0933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1067535..1068581
Genome map
AA seq 348 aa AA seqDB search
MILLQNIKRCSLKQLKVLATLLLSLSLPTLEAAENRDSDSIVWHLDYQEALQKSKEAELP
LLVIFSGSDWNGPCMKIRKEVLESPEFIKRVQGKFVCVEVEYLKHRPQVENIRQQNLALK
SKFKINELPCMILLSHEEREIYRIGSFGNETGSNLGDSLCHIVESDSLLRRAFPMMTSLS
LSELQRYYRLAEELSHKEFLKHALELGVRSDDYFFLSEKFRLLVEVGKMDSEECQRIKKR
LLNKDPKNEKQTHFTVALIEFQELAKRSRAGVRQDASQVIAPLESYISQFGQQDKDNLWR
VEMMIAQFYLDSDQWHHALQHAEVAFEAAPNEVRSHISRSLEYIRHQS
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtgatcctgttacaaaatatcaaaagatgttccttaaaacagttgaaggtcttggctact
cttttgttgagcttgagcttacctacgctagaagcagccgagaacagagattctgattct
attgtttggcacctggattatcaggaggctttgcaaaagagcaaggaagcagagcttcct
ttgcttgttattttttctggttccgattggaatggcccttgtatgaaaatccgtaaagag
gtgttggaatcacctgaattcatcaaaagagttcaggggaagtttgtctgtgtggaagtg
gagtatctgaaacatagaccgcaggttgaaaacattcgtcagcaaaatcttgctttgaaa
tctaaatttaaaattaatgaactgccctgcatgattttgctctcacatgaggagagagaa
atctacagaataggttcttttggtaatgagacgggttccaatttaggggacagtctttgt
catatcgtagagagtgattctttactaagaagggcgtttcctatgatgacgtcgctatct
ttatcggaactgcaaaggtattaccgacttgctgaagagctctctcataaagaattcctc
aagcatgctcttgagcttggggtgcgcagtgacgattacttctttttatctgagaagttt
cggttattggtagaagtgggcaaaatggattctgaggagtgtcagagaattaaaaaacgc
cttctcaacaaagatcctaaaaatgaaaagcaaacccattttaccgtagccctgatagag
tttcaagaactggcaaaaagatctcgagctggtgtgcgccaagatgccagccaagtcatc
gctcctctagagagttatatttctcaatttgggcagcaagataaggataacttgtggcgt
gtagaaatgatgatagcgcagttttacttagattctgatcaatggcatcatgctttgcaa
catgcagaggttgcctttgaagctgctcctaacgaggtgcggtcacacatttctcgctct
ttggagtacattcgccaccagtcgtag

DBGET integrated database retrieval system