KEGG   Chlamydia pneumoniae CWL029: CPn1063Help
Entry
CPn1063           CDS       T00021                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cpn  Chlamydia pneumoniae CWL029
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:cpn01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cpn01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cpn00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cpn00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1219951..1220715
Genome map
AA seq 254 aa AA seqDB search
MTRQSYVLGNWKMHKTIQEAKEYVQTLASLLQGEPLSCTIGIASPFTSLRAIHEVINTTG
AFLWLGAQNVHPELSGAFTGEISLPMLKEVGVEFVLVGHSERRHIFGESDAFIASKVKSV
AQAGLVPVLCVGESLEVREEGKAHQVIKKQLLLGLEQMDNGSEFLIAYEPVWAIGTGKVA
EASDVQDIHMFCREVVAERFSEATAEEISILYGGSVKVDNAQRFGQCSDVDGLLVGGASL
EGQSFFEVAKNFNV
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgacaaggcagagttatgttttgggcaattggaaaatgcacaaaacaatccaagaagct
aaagagtatgttcaaacattagcttctttactacaaggagaacctctttcctgcactata
ggcatagcttctccatttacctctttgagagcgattcatgaggtgataaacactacggga
gcttttctctggttgggagcacaaaatgtccatcccgagctttcgggtgcttttactgga
gaaatttccttacctatgcttaaggaggtaggagtggaatttgttttagtaggtcactcc
gagcgtcgtcatatttttggagagagtgatgcctttattgcttcaaaggtaaagtctgta
gctcaggcgggactcgtgcctgttctttgtgttggagagagcttagaagttcgtgaagag
ggaaaggcgcatcaggtaatcaaaaaacagttgcttttgggattggaacagatggataat
ggttccgaatttttgatcgcctatgaaccagtatgggctatcggcacagggaaggtggca
gaagcttcggatgtgcaagatattcatatgttttgtcgtgaggtagtggcagagaggttc
tcagaagctacagctgaagagatttcgattttgtacggaggatctgtgaaggtcgataat
gctcagcgatttgggcaatgtagcgacgtcgatggtcttttagttggcggagcttcttta
gaagggcaaagtttttttgaagtcgctaaaaattttaatgtataa

DBGET integrated database retrieval system