KEGG   Coprothermobacter proteolyticus: COPRO5265_0034Help
Entry
COPRO5265_0034    CDS       T00773                                 

Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cpo  Coprothermobacter proteolyticus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cpo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    COPRO5265_0034
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    COPRO5265_0034
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    COPRO5265_0034
Enzymes [BR:cpo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     COPRO5265_0034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
30731..31921
Genome map
AA seq 396 aa AA seqDB search
MITNKKAKFGEFGGQYVPEAVMQALIELENEFNRAKNDEQFLEEYHYYLREYDGRPTPLY
YAENLTRTLGGAKIYLKREDLNHTGAHKINNALGQVLLAKRMGKKRIIAETGAGQHGVAT
ATVAALFGMECEIFMGAEDVQRQRLNVFRMELLGAKVRSVTSGSSTLKDAVNEAIKDWVE
HIDSTFYLIGSAVGPHPYPLMVREFQKVIGEEAREQILQKEGRLPDYVLACVGGGSNAIG
IFYPFVQDTQVRLIGVEAAGKGLDTNKHAATFNRGTVGIIHGMKTYLLQSPDGEITEPYS
VAAGLDYPGVGPEHSYLKDIGRAKYESATDEEALAAFELLSRVEGIIPALESSHALAYAI
KLAPKLSKDQIIIVNLSGRGDKDVQQVAKMKGIEEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgattacaaataaaaaggcaaaattcggtgagtttggagggcaatacgtgcccgaggcc
gtaatgcaggcactcattgagctggaaaatgaattcaacagagcaaaaaatgatgagcag
ttcttggaagaataccactattacttacgtgaatatgatggacgtcccactccactttac
tatgcagaaaatctaaccagaacgttaggtggagccaagatttacctaaagagggaagac
ctgaaccacacgggcgctcacaaaatcaacaacgcattgggacaagttcttttagcaaaa
cgcatgggaaagaaacgcatcattgcggaaactggtgctgggcaacacggcgtcgccaca
gctactgtggcagcattgttcggcatggaatgtgaaatcttcatgggagcagaagacgtg
cagagacagcggttgaacgtttttcgcatggaacttcttggcgcaaaggtgagaagcgta
acctctgggagttccacccttaaagacgctgtgaacgaggccataaaggattgggtagaa
cacatcgatagcacattctaccttatcggttcagcagtaggaccacacccctacccactc
atggtcagggaatttcaaaaggttattggagaagaagctcgggaacaaatacttcaaaaa
gaagggcgccttccagactacgtgctggcttgcgtgggcggaggtagcaatgctattggc
attttctatccgttcgtgcaggacacccaagttaggctgattggtgtggaggcagcaggc
aaaggtcttgacactaacaagcacgcagccacattcaacagaggaaccgtgggtatcatt
catggcatgaaaacctatctattgcaaagccctgatggtgaaatcacagagccttactca
gtggcagcaggcctggattatccgggtgtgggacctgaacacagctacttaaaagacatc
ggcagagccaagtatgaaagtgccaccgacgaagaagcattggcagcctttgaacttcta
tcacgtgtagaaggcatcattcctgccttagaaagctcgcatgccttggcatacgctata
aaactggcgccaaagctgagcaaagatcagatcatcattgtgaacctatcaggcagagga
gacaaagacgtgcagcaagtggcaaaaatgaaaggcattgaagaaatttag

DBGET integrated database retrieval system