KEGG   Coprothermobacter proteolyticus: COPRO5265_0115Help
Entry
COPRO5265_0115    CDS       T00773                                 

Definition
beta-N-acetylglucosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cpo  Coprothermobacter proteolyticus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    COPRO5265_0115
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    COPRO5265_0115
Enzymes [BR:cpo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     COPRO5265_0115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(110962..112140)
Genome map
AA seq 392 aa AA seqDB search
MTPTQSGTDVTPTTAVNQNTQNDVIDSIIANMDLQEKIGQMFIVSFTGTNVSADLITLVH
DYHVGGVILFSENIQDDKQLLALLNGIKALNEGNKLPILISTDQEGGRISRLPSRATKFP
SNLIIGKRNSATLSYQIGSILGTEMKAYGFNMDFAPVLDVVTNPQNKVIGDRSFGSNPDL
VSTLGVATMKGISSSGVIPVVKHFPGHGDTSVDSHQELPVSNATLPHLRSFELLPFEKAI
QNGASVVMVAHIKFANVDPSGLPASLSEVFISDILRNELGFSGVVITDDLHMEAITKHYS
VGDAAIKAVQAGADMVLICHSLDEQKQAINALVHAVKTGQISEERINESIKRIAMLKRHY
DLTDEPSSIAAVLSEVGTEEHADVAKEASVAP
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
ttgacgccaactcaatctggtacggacgttactccaacaacggcggtaaaccaaaacact
cagaacgatgttattgattccatcattgcgaatatggatttgcaggagaaaattggccaa
atgttcattgtcagtttcacgggcacgaacgtatctgctgacctcatcacgcttgtacat
gactaccacgtaggtggcgttattcttttttcggaaaacatacaagacgacaaacaactt
ctcgcactactgaacggcataaaagctctaaatgaaggcaataagttacctattctcata
tctacagatcaagagggaggccgcatttctcgtttaccctccagagcaacaaagttccct
tccaatctaatcataggtaaaaggaactcggctacactgagctaccaaataggaagcatt
ctaggtacagaaatgaaggcttacggtttcaacatggattttgcgccggttcttgatgtg
gttactaacccacaaaacaaagtgattggcgaccgctctttcggaagtaaccccgacttg
gtttccactttaggagttgccaccatgaagggcatctcttcctcaggcgtcataccagtg
gtaaaacattttccggggcacggtgatacatcggtggattcacatcaggaactaccagtt
tccaacgcaacactgcctcaccttcgctcctttgaacttttgcctttcgagaaggcaata
cagaacggtgcaagtgtggtcatggtagctcacataaagtttgcgaatgtagatccatca
ggcctcccggcatcactctcggaagtgtttatctctgatattctaagaaacgagcttggg
ttttcaggcgtagtcattaccgacgatttgcacatggaagccataaccaaacactacagt
gttggtgatgctgcgataaaggctgtgcaagccggtgctgacatggtgcttatttgccac
agtcttgacgagcaaaaacaagcaataaatgctttggtacatgcagttaaaactggtcaa
atcagtgaagagcgcatcaatgaatcaataaagcgtatagccatgttaaaacggcattac
gatctaacagacgaaccgtcctccatcgcggcagttcttagtgaagtgggaacagaggaa
catgcggacgtcgcaaaagaggcaagcgtggctccgtag

DBGET integrated database retrieval system