KEGG   Coprothermobacter proteolyticus: COPRO5265_0137Help
Entry
COPRO5265_0137    CDS       T00773                                 

Definition
tungsten-containing aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
cpo  Coprothermobacter proteolyticus
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:cpo01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cpo00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
135246..137045
Genome map
AA seq 599 aa AA seqDB search
MGYAGKLLRVNLSTGEIKTEQLDFALSRMFLGGRGLASKILYDEIDPKVDPLSPENKIIF
AAGPLTGTNAPTGGRYMVITKGPLTGTIASSNSGGFFGAELKFAGYDMVIFEGKSDKPVY
LSIHDEEVQLKDATQLWGKDVFETTDILANEFGDGKARVSCIGPAGENLVKFAGVMNDKH
RAAGRTGVGAVMGSKNLKAIVVRGSGRPKPSSPDFMEVVRQKINIIKQNPVTGEGLPALG
TKVLDNIINQSGAYPTRNFQESVFERTHEVSGEALVEKKYLKKNTACFACPIGCGRVITL
PNGIDSEGPEYEAGWAYGADCGVDDLIAICEANHLCNKYGIDPISAGSTIACAMELYEKG
YLPKEDLNKGPEPIFGSSEAIVYYTKAIAFREGLGDKLAEGSKRLSEMYGHPEFAMHVKG
QELPAYDPRGVQGHGLQYATSNRGGCHVRGYMISPEVLGIPEKLDPQELNGKPEWVKTFQ
DLTAVIDSAGLCLFTSFALTADDYRDLVNADTGFNYTTEELMKVGERVWNLERLFNLKAG
FTKADDTLPKRLLEQPVAEGPNKGAVHHLSELLPLYYQARGWNEDGVPTPEKLSELGLE
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgggttatgctgggaagctactcagggttaacctgagcacaggggaaataaaaaccgag
caactggacttcgctttatcgcgcatgtttcttgggggcagaggtttggcaagcaagata
ctttacgatgaaattgaccccaaggtagatccactttctccagaaaataagatcattttt
gctgcaggtccactcactgggacaaatgctcccacaggcggacgttatatggttattact
aaggggccacttactggtaccatagctagcagcaactctgggggtttcttcggagctgag
ttgaagtttgcaggctacgacatggtcatatttgaaggtaaatctgataagccagtttac
ctttccatacatgatgaagaggttcaacttaaggatgcaacacagttgtggggcaaggat
gtatttgagaccacagacatactggcaaatgagtttggtgatggtaaagctcgcgtttca
tgcattggccctgccggtgaaaacttggttaaatttgcgggtgttatgaacgataagcac
cgtgctgctggtagaacaggcgttggggctgtcatgggaagcaagaacctaaaagccatt
gtggtaagaggcagtggaaggccaaaaccaagtagccctgattttatggaggtagtaaga
caaaaaatcaatatcataaaacaaaatcccgtaactggagaaggtttaccagcactgggt
actaaagtacttgacaacattatcaaccaatcaggtgcataccccacaagaaatttccag
gaatcggtttttgagagaactcatgaagtgtctggagaagctttggtggaaaagaagtac
ctgaaaaagaatacggcatgcttcgcctgccccatcggttgcggtcgtgtcataactctg
ccaaacggtattgactctgaaggacctgaatatgaagcaggctgggcctatggtgcagat
tgcggtgttgatgatctgatcgccatctgtgaggcaaatcatctttgcaataagtacggc
attgatcccatatctgctggttctaccattgcctgtgccatggagctttatgagaaaggt
tatctgcccaaagaagaccttaacaaagggcctgagcccatattcggtagctctgaagcc
attgtgtactatacaaaagccatagcttttagggaagggctaggggacaagctggctgag
ggtagcaaacgactttcagaaatgtacggacatcctgaatttgctatgcacgtaaaggga
caggaactacctgcttacgatccaagaggtgttcaaggacacggtcttcagtacgctaca
agtaaccgtggtggatgccacgtcagaggttacatgatctctcccgaagtcttgggtatt
cctgaaaagttggatcctcaggagctcaacggcaagccagaatgggtaaagaccttccaa
gatttgactgcggtcattgattctgcgggattgtgtctgtttacctcgtttgcacttaca
gctgatgattacagggaccttgtaaatgctgatacgggttttaactacaccacagaagaa
ctaatgaaagttggcgaacgggtttggaacttagagcgtttgtttaacttgaaggccgga
tttaccaaagctgacgatacactaccgaaacggcttcttgagcagcctgtggcagaagga
cccaataaaggagctgtgcatcacctgtctgaactgctaccactttattaccaagcgcgt
ggctggaatgaagatggcgttcccacgccggagaaactaagcgagcttggtctggagtag

DBGET integrated database retrieval system