KEGG   Coprothermobacter proteolyticus: COPRO5265_0206Help
Entry
COPRO5265_0206    CDS       T00773                                 

Definition
dihydroflavonol 4-reductase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
cpo  Coprothermobacter proteolyticus
Brite
Enzymes [BR:cpo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     COPRO5265_0206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
206547..207542
Genome map
AA seq 331 aa AA seqDB search
MLVAVTGATGLVGNNVVRFFLKLGFDILAVVHPEEGLQSLEGLSVRVVRADITNPEQIKE
ALKGAEAVVHAAGLVSITEASKDKLEAVNVEGTKNVIEACKANGVKKLIYISSIHALPAD
EEGPIRETKDLSVNRVQGAYAKTKVKATLLAFQAAKDGLWTVVLHPTGIVGPYDFRTSIV
GKLIINALSGKLKWYVSGGYDFVDARDVAKATYLALEKGKCGENYIVAGDYISMKDFLEQ
CFKTAGKPFNLKEIPYGLALAVSPFMEWYEVSKGKEPQMSIYALKTLRSKSDIDSSKIRE
ELGFEPMPMTQTVKDLTNWYLSRMKEAEIRR
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
gtgttagtagcagtaacaggtgcaacggggttggttggcaacaacgtggttaggttcttt
ctcaagttgggtttcgatattttagctgtggtgcacccggaggagggcttgcagtcctta
gagggcttaagtgtcagggtggtgcgtgccgatataacgaaccctgagcagataaaagaa
gcgctgaaaggtgcagaagcggtggtgcatgctgctggtttagttagcataactgaggcc
agtaaggataagttggaagctgtcaacgtggaaggtaccaaaaacgtcattgaagcgtgc
aaagcgaacggtgttaagaagctgatctacataagttccatacacgctttgcctgctgac
gaggaaggtcccataagagaaactaaagacctttcagtaaatcgagtgcagggagcttac
gcaaaaactaaggtaaaagcaacgctactggcgtttcaggcagcgaaggatggactatgg
actgtggttttacatcccacgggcattgtgggaccctatgattttcgcacgtccattgta
ggaaagctaatcataaatgctcttagcggtaagctgaagtggtatgtatcagggggttac
gactttgtggatgcacgtgatgtggcaaaagccacttacttggcactagaaaagggtaaa
tgcggcgagaactacattgtggcaggcgactacatttccatgaaggattttttggagcag
tgcttcaaaacggctggcaaaccctttaatctgaaagaaatcccctatggtctagctttg
gcagtcagccccttcatggaatggtatgaggtcagcaaaggtaaagaaccacagatgagc
atctatgcactaaagactcttcgaagtaaaagcgacatagatagctcaaagatccgtgaa
gagttggggtttgagcccatgccaatgactcaaacagtcaaggatcttaccaactggtat
ttaagcagaatgaaagaggccgaaattaggcgatga

DBGET integrated database retrieval system