KEGG   Coprothermobacter proteolyticus: COPRO5265_0216Help
Entry
COPRO5265_0216    CDS       T00773                                 

Gene name
pfkB
Definition
1-phosphofructokinase (EC:2.7.1.56)
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
cpo  Coprothermobacter proteolyticus
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cpo00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
215094..216017
Genome map
AA seq 307 aa AA seqDB search
MNNGVATVTLNPAIDHTIYVNTFTPNTLNRAEAVEYHIGGKGINVSKVLSTLGQPSVALG
FLGRNALYFEEELKAASIETDFVQVSGRTRTNIKVIDKSNLGCTEINEPGPYIDTASWEK
LVKKVTSWAAKCEYVVIAGSLPPGVPHDSYKFLIQEAKKQGAKTVLDADGEALKRGLQAM
PFMIKPNIHELEGLTGKQLSGSKQELLSVCRELLLAGISVVVVSMGSEGSIYASQEGIYR
VYPLNLEVKNTVGAGDAMVAGLIHGMSKGLQAEKLAAFGAAVSACQIVDDFGRLEEFSKQ
IRVERWV
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatggcgtggccacggtaaccttgaaccctgctattgaccacacgatttatgta
aatacgtttacacccaatactctaaacagagcggaagcagttgagtaccacattggcggc
aaaggcataaatgtctccaaagtactttccacattggggcaacccagcgtagctttgggt
ttcttaggtaggaatgcgctgtatttcgaagaggaactaaaagcagcaagtattgagact
gattttgtgcaagtctctggcagaaccagaaccaacataaaagtcatcgataagagtaac
ttaggctgtacggagataaacgagccgggaccatatattgacactgctagttgggaaaag
ctagtaaagaaagttacttcgtgggcagcgaagtgcgagtacgtagttattgcaggtagt
ctgccaccaggtgtgccccatgacagctacaagtttcttattcaagaggcaaaaaaacaa
ggggcaaaaacagttctggatgcagatggagaagccctgaagagaggtttacaggctatg
cctttcatgattaaacccaacatccatgagcttgaggggttgactggtaagcaattatct
ggaagcaaacaagaattgctaagtgtttgccgcgaactacttttagctggtatatcagtg
gtggttgtgtccatgggaagtgaaggtagcatttacgcttctcaggaaggcatttatagg
gtttacccgctcaatctggaggttaaaaacaccgtgggtgcaggagatgccatggtagct
ggtttgatccatggtatgagcaaaggattgcaggcggagaagttggcagcttttggggct
gccgtttcagcctgtcaaattgtggatgactttggcagactggaggagttttcgaaacaa
ataagagtggagaggtgggtgtga

DBGET integrated database retrieval system