KEGG   Coprothermobacter proteolyticus: COPRO5265_0216Help
Entry
COPRO5265_0216    CDS       T00773                                 

Definition
(GenBank) 1-phosphofructokinase
  KO
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
cpo  Coprothermobacter proteolyticus
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:cpo00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    COPRO5265_0216
Enzymes [BR:cpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.56  1-phosphofructokinase
     COPRO5265_0216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
215106..216017
Genome map
AA seq 303 aa AA seqDB search
MATVTLNPAIDHTIYVNTFTPNTLNRAEAVEYHIGGKGINVSKVLSTLGQPSVALGFLGR
NALYFEEELKAASIETDFVQVSGRTRTNIKVIDKSNLGCTEINEPGPYIDTASWEKLVKK
VTSWAAKCEYVVIAGSLPPGVPHDSYKFLIQEAKKQGAKTVLDADGEALKRGLQAMPFMI
KPNIHELEGLTGKQLSGSKQELLSVCRELLLAGISVVVVSMGSEGSIYASQEGIYRVYPL
NLEVKNTVGAGDAMVAGLIHGMSKGLQAEKLAAFGAAVSACQIVDDFGRLEEFSKQIRVE
RWV
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtggccacggtaaccttgaaccctgctattgaccacacgatttatgtaaatacgtttaca
cccaatactctaaacagagcggaagcagttgagtaccacattggcggcaaaggcataaat
gtctccaaagtactttccacattggggcaacccagcgtagctttgggtttcttaggtagg
aatgcgctgtatttcgaagaggaactaaaagcagcaagtattgagactgattttgtgcaa
gtctctggcagaaccagaaccaacataaaagtcatcgataagagtaacttaggctgtacg
gagataaacgagccgggaccatatattgacactgctagttgggaaaagctagtaaagaaa
gttacttcgtgggcagcgaagtgcgagtacgtagttattgcaggtagtctgccaccaggt
gtgccccatgacagctacaagtttcttattcaagaggcaaaaaaacaaggggcaaaaaca
gttctggatgcagatggagaagccctgaagagaggtttacaggctatgcctttcatgatt
aaacccaacatccatgagcttgaggggttgactggtaagcaattatctggaagcaaacaa
gaattgctaagtgtttgccgcgaactacttttagctggtatatcagtggtggttgtgtcc
atgggaagtgaaggtagcatttacgcttctcaggaaggcatttatagggtttacccgctc
aatctggaggttaaaaacaccgtgggtgcaggagatgccatggtagctggtttgatccat
ggtatgagcaaaggattgcaggcggagaagttggcagcttttggggctgccgtttcagcc
tgtcaaattgtggatgactttggcagactggaggagttttcgaaacaaataagagtggag
aggtgggtgtga

DBGET integrated database retrieval system