KEGG   Coprothermobacter proteolyticus: COPRO5265_0269Help
Entry
COPRO5265_0269    CDS       T00773                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cpo  Coprothermobacter proteolyticus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpo00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    COPRO5265_0269 (glpK)
Enzymes [BR:cpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     COPRO5265_0269 (glpK)
Exosome [BR:cpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   COPRO5265_0269 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
259999..261495
Genome map
AA seq 498 aa AA seqDB search
MEQKKYVLSFDQGTTSSRAMIFDQNGCIVSMAQKEFPQIFPKPGWVEHDPEDIWNSQIDV
AKEAMLKAGLTAEDIAALGIANQRETTILWDRNTGKPVYNAIVWQCRRTAEFCDELKERG
WEKPIREKTGLVIDAYFSGTKIKWILDNVPGVRERAEKGEVLFGNVDTFLIWRLTGGKVH
VTDYTNASRTMIFNIHALDWDDDILQELDIPRAMLPKVCPSSHLFGYTDAKLFGGEIPIA
GDAGDQQAALFGQACFEPGSAKNTYGTGSFLLVNTGSKPVESKHGLITTVAFGLEDSVCY
ALEGSIFITGAAVQWLRDGLGIIKVADEVETLARQVEDTAGVYFVPAFVGLGAPYWDMYA
RGMIIGITRGTTACHLARATLEAMAYQTRDVLEAMKSDCGFDLKLLRADGGASVDNLLLQ
IQADVLGLAVQRPVVRETTALGTAYLAGLATGFWHNLEEIANIWQLDRTFEPQITAIKRE
EMYAGWKRAVERARGWTQ
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaaagaaatatgttttatcctttgaccagggtacgaccagtagtagggccatg
atatttgaccaaaatggatgcatagtaagcatggctcagaaagaatttccacaaattttt
ccaaaacctggttgggttgaacatgacccagaggatatatggaatagtcaaatagatgtg
gcaaaggaagccatgctaaaagcgggtcttactgccgaagacattgccgctttgggcata
gccaatcaacgtgaaaccacaatcctttgggacagaaatactggtaaaccggtttacaat
gccattgtttggcagtgccgtagaactgcagagttttgtgacgagctcaaggaaagagga
tgggaaaaacccataagggaaaagacaggcttagtcattgacgcttattttagtgggaca
aagattaagtggatactagacaatgtgccaggggtaagagaaagagccgaaaaaggggaa
gtgctttttggcaacgtggacaccttcctcatttggcgtctcacaggcggtaaggtgcat
gtaactgattacaccaatgcttccagaactatgatctttaacatacatgcattggactgg
gacgatgacatactccaggagctggacatacccagagctatgcttccaaaggtgtgtcct
tcatctcacttatttggttatactgatgccaaattatttggcggtgagattcccatagcg
ggtgatgcaggtgaccaacaagctgcgttgtttgggcaagcctgtttcgaacccggttct
gctaagaacacctacggcactggttctttcctgctggttaacactggcagtaagccggtg
gagagcaaacacggcttaattaccactgttgctttcgggctggaggacagcgtttgctat
gctttagaaggttccatttttatcaccggtgctgctgttcagtggcttcgtgacggttta
ggaattataaaggtagcagatgaagtggaaaccttggctaggcaagtcgaagatacagct
ggcgtttattttgtaccagcctttgtggggttaggtgctccttactgggacatgtatgcc
cgcggtatgatcattggaattacacggggcacaacagcatgccatctagctcgagcaacg
ctggaggccatggcttatcaaacccgagacgtgttggaagcaatgaagagcgattgcggt
tttgacttaaaactacttagggccgatggaggagcctctgtggataatctactgcttcaa
atccaagcggatgttttggggctcgcagtacaaaggccagtagtaagagaaactactgca
ctgggtacggcctacttggcaggattggccacaggcttctggcataatctggaagagatc
gcgaacatttggcaactggatagaacttttgagcctcaaataacagcaataaagagagag
gagatgtacgctggatggaaacgagcagtggaaagagctcggggatggacccaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system