KEGG   Coprothermobacter proteolyticus: COPRO5265_0340Help
Entry
COPRO5265_0340    CDS       T00773                                 

Definition
chemotaxis response regulator protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cpo  Coprothermobacter proteolyticus
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cpo00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    COPRO5265_0340
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    COPRO5265_0340
Enzymes [BR:cpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     COPRO5265_0340
Two-component system [BR:cpo02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   COPRO5265_0340
Bacterial motility proteins [BR:cpo02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    COPRO5265_0340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
318725..319774
Genome map
AA seq 349 aa AA seqDB search
MRSTGRILVVEDSTFVSKVVCDILQKNLNVVCDTASSVKEALVKIRLYPYDVILLDYVLP
DGTGIDILRKGRDSLKGYVILFSSLAQEGADITVQALSEGAVDFILKPGWGGMLADDFSR
ELVAKIEVLLSKKPVESTEKVLKQVNTAELKTGIKLVNCPGKAEGIVVVASSTGGPQALR
KFLGKFERVNVPVVIAQHMPPFFTKSLAEQLCKTTKLDVMEATSTVELEPNRVYVITGGK
HGVVSGGVLEIIDGPAVNGVKPAADLLFASAAEAYGTQTLGVVLTGMGKDGLEGSKFIKQ
LGGKVIAESQESAVVWGMPGEVVKCGLADAIDHLEVLPYRVEEIIKWWK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcggagcactggtcgcattctagttgtggaagattctacttttgttagcaaagttgtg
tgcgatattctacaaaaaaacttgaatgtggtttgtgataccgcatccagtgtcaaagag
gcgttagtcaaaataaggctttacccttacgatgttattctccttgattatgttctgcct
gacggtacaggcattgatattctcagaaagggcagggatagtttaaaaggttacgtgatt
ctgttttcatcattggcccaggaaggggctgatataactgttcaagctctctcagaaggt
gctgttgatttcatattgaagcctggttggggtggtatgctcgcagacgactttagtcgc
gaactagttgccaaaattgaagtgctgctttcgaagaaacctgtcgaatctactgaaaag
gtcttaaagcaagttaacacggcagaactgaaaacagggattaagctggttaactgtccg
ggtaaggcagaaggcatcgttgtggtagcgtcgtcaaccggaggccctcaggcccttcgg
aaatttcttggcaagtttgagcgtgttaatgttcccgtggttatagcgcagcatatgccc
ccattttttacaaaaagcttagctgagcaactttgcaagacgactaagttggatgtaatg
gaagccacttcaacagtagagcttgagcctaacagagtttacgtgattactggaggcaag
cacggagttgtaagtggtggtgttcttgagataatagatggtcctgctgttaatggggta
aagccagctgctgatctgctttttgcttctgccgctgaagcctatggaactcaaacgctg
ggtgtagtgcttacaggcatgggtaaggatggactagagggaagcaaattcatcaaacaa
ttaggtggcaaagttatagcggaatctcaagaaagtgctgtggtttggggaatgcctgga
gaagtggtgaagtgtggattagcagatgctattgatcatctggaagttttaccctatcgt
gttgaggagatcatcaagtggtggaagtga

DBGET integrated database retrieval system