KEGG   Coprothermobacter proteolyticus: COPRO5265_0388Help
Entry
COPRO5265_0388    CDS       T00773                                 

Definition
(GenBank) nicotinamidase
  KO
K08281  nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cpo  Coprothermobacter proteolyticus
Pathway
cpo00760  Nicotinate and nicotinamide metabolism
cpo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    COPRO5265_0388
Enzymes [BR:cpo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     COPRO5265_0388
    3.5.1.-  
     COPRO5265_0388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase TFX_C
Motif
Other DBs
NCBI-ProteinID: ACI17711
UniProt: B5Y7K7
Position
359208..359789
Genome map
AA seq 193 aa AA seqDB search
MIDFQPTDGLIVVDIQRDFCPGGTLAVPQGDEIIDVVNRIIKKAEEAGSVIVYTRDWHPE
NHLSFKAYGGIWPPHCVQWTPGAEFHPQLYLSEKGIILDKGTHPEFEAYSGFQGTGLHQI
FKDRGVNRVFVVGLATDYCVKETAVDALRYRYETFVVADAVKGVNVNPDDSQKALQHIED
MGGKVILSQELLP
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatagattttcagcccaccgacgggctcattgtagttgatattcaaagggatttttgt
cctgggggcaccttggcggtgccccagggagatgaaataatagatgtggtaaacaggatc
attaagaaagcagaagaagctggttcagtaatcgtttacaccagagattggcatccagaa
aatcatctttcattcaaagcatatggtggtatttggccacctcactgtgtgcagtggaca
ccaggtgctgaatttcacccccaactttatctttctgaaaagggcatcattttagacaaa
ggcacgcatccggagtttgaagcatatagtggttttcaaggtacgggtctgcatcaaatt
tttaaagatcgtggcgtaaacagggttttcgttgtgggtcttgctactgactactgtgta
aaagaaacggctgttgacgcgcttcgctacaggtatgaaacctttgttgtggctgacgca
gtaaaaggtgtaaatgttaatcctgatgattcccagaaagcgctgcagcacatcgaggac
atgggcggtaaggtcatactttctcaggagttgcttccgtga

DBGET integrated database retrieval system