KEGG   Coprothermobacter proteolyticus: COPRO5265_0439Help
Entry
COPRO5265_0439    CDS       T00773                                 

Definition
2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cpo  Coprothermobacter proteolyticus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    COPRO5265_0439
   01230 Biosynthesis of amino acids
    COPRO5265_0439
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COPRO5265_0439
  Energy metabolism
   00680 Methane metabolism
    COPRO5265_0439
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    COPRO5265_0439
Enzymes [BR:cpo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     COPRO5265_0439
Exosome [BR:cpo04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   COPRO5265_0439
  Exosomal proteins of melanoma cells
   COPRO5265_0439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
400660..401406
Genome map
AA seq 248 aa AA seqDB search
MYKVVMIRHGESEWNKLNLFTGWTDVDLSDRGVEEAIWAGKKLKEEGYTFDVAFTSVLKR
AIKTLNLVLEQMNLDWIPVYKHWRLNERHYGALQGLNKAEMTERYGEQQVLLWRRSYDVP
PPPLEKTDPRWPGNDPRYALVPEDELPLCESLKDTEARVVPYWADMIVPAIKEGKKVLIS
AHGNSMRAIVKYLDKMSGEEIAKTNIPTGIPLVYELDESMRPIRHYYLADEDFLKAKEQE
VANQIYKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtataaagttgtcatgataaggcacggggaaagcgaatggaataagctgaatttgttc
actggttggactgatgtggacctttctgatagaggtgtagaagaagccatttgggctggt
aagaaactaaaagaagaaggttacacctttgatgttgcatttacttccgtactgaaacgt
gccattaaaacgttgaatttggtgcttgaacagatgaatctggattggatccctgtgtac
aagcattggagactgaatgagcgccattatggtgctctgcagggcttgaataaagcagaa
atgaccgaaagatatggtgagcagcaggtactcctgtggaggcgttcttatgatgtacca
ccgccaccactggaaaagacagacccaaggtggcctggcaatgatccacgttatgcgctt
gttcctgaagacgaactaccactttgcgagtctttgaaggataccgaagcgcgtgtggtc
ccttattgggctgacatgatcgtacctgccataaaagagggcaaaaaggtactcatttcc
gctcacggtaacagtatgcgtgccattgtgaagtatttggataagatgagcggtgaagaa
attgcgaagacgaatattcccacgggtattccgctggtttacgagcttgatgagtctatg
aggcccatcaggcactactacttggctgatgaggacttcttaaaagccaaggagcaagaa
gtagctaaccagatttacaagaaatag

DBGET integrated database retrieval system