KEGG   Coprothermobacter proteolyticus: COPRO5265_0439Help
Entry
COPRO5265_0439    CDS       T00773                                 

Definition
2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cpo  Coprothermobacter proteolyticus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    COPRO5265_0439
   01230 Biosynthesis of amino acids
    COPRO5265_0439
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COPRO5265_0439
  Energy metabolism
   00680 Methane metabolism
    COPRO5265_0439
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    COPRO5265_0439
Enzymes [BR:cpo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     COPRO5265_0439
Exosome [BR:cpo04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   COPRO5265_0439
  Exosomal proteins of melanoma cells
   COPRO5265_0439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
400660..401406
Genome map
AA seq 248 aa AA seqDB search
MYKVVMIRHGESEWNKLNLFTGWTDVDLSDRGVEEAIWAGKKLKEEGYTFDVAFTSVLKR
AIKTLNLVLEQMNLDWIPVYKHWRLNERHYGALQGLNKAEMTERYGEQQVLLWRRSYDVP
PPPLEKTDPRWPGNDPRYALVPEDELPLCESLKDTEARVVPYWADMIVPAIKEGKKVLIS
AHGNSMRAIVKYLDKMSGEEIAKTNIPTGIPLVYELDESMRPIRHYYLADEDFLKAKEQE
VANQIYKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtataaagttgtcatgataaggcacggggaaagcgaatggaataagctgaatttgttc
actggttggactgatgtggacctttctgatagaggtgtagaagaagccatttgggctggt
aagaaactaaaagaagaaggttacacctttgatgttgcatttacttccgtactgaaacgt
gccattaaaacgttgaatttggtgcttgaacagatgaatctggattggatccctgtgtac
aagcattggagactgaatgagcgccattatggtgctctgcagggcttgaataaagcagaa
atgaccgaaagatatggtgagcagcaggtactcctgtggaggcgttcttatgatgtacca
ccgccaccactggaaaagacagacccaaggtggcctggcaatgatccacgttatgcgctt
gttcctgaagacgaactaccactttgcgagtctttgaaggataccgaagcgcgtgtggtc
ccttattgggctgacatgatcgtacctgccataaaagagggcaaaaaggtactcatttcc
gctcacggtaacagtatgcgtgccattgtgaagtatttggataagatgagcggtgaagaa
attgcgaagacgaatattcccacgggtattccgctggtttacgagcttgatgagtctatg
aggcccatcaggcactactacttggctgatgaggacttcttaaaagccaaggagcaagaa
gtagctaaccagatttacaagaaatag

DBGET integrated database retrieval system