KEGG   Coprothermobacter proteolyticus: COPRO5265_0459Help
Entry
COPRO5265_0459    CDS       T00773                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cpo  Coprothermobacter proteolyticus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cpo03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
423456..424061
Genome map
AA seq 201 aa AA seqDB search
MNLEELSKQFRRLPGVGPRTAEKMAYYWLTLEDDEAERFLRTLENFRRQITLCKRCHNLA
VGSDLCNICQDNRRDKAIVVVETPQDVENIEQAGIYHGYYHVLHGLISPRKGVTPEQLFI
SDLFDRIVDEGITQVIIATSFTMEGDITADYLAKQLKTLQPNIPIYRLGTGLPVGGELNY
ADKATLRAAFITKQKVGEEND
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
ttgaacttagaggaattgagtaagcagtttaggcgccttcctggggtcgggcctaggacg
gctgaaaagatggcttactactggctgacgctggaagatgacgaggcagagcgttttctt
cgtacattggaaaatttcaggcgccagataacgttgtgcaagaggtgtcataacttggct
gtgggaagcgatctttgcaacatctgtcaggataacagaagggacaaagccattgtagtg
gtggagacacctcaggatgtggaaaacattgagcaagcgggcatttatcatgggtactac
catgtactccatgggctaatctcgccacggaagggcgtcacacccgagcaattgtttata
tcggatctgtttgatcgcatagtggatgaaggcataactcaggtaatcattgccacttct
tttaccatggagggtgacattactgctgattatcttgcaaaacagctaaaaactttgcag
ccaaacatacccatttacaggttaggaacgggtttacccgtgggtggcgaactgaactac
gcagacaaagccaccctaagggcggcgtttataaccaaacaaaaagtgggggaggaaaat
gactaa

DBGET integrated database retrieval system