KEGG   Coprothermobacter proteolyticus: COPRO5265_0581Help
Entry
COPRO5265_0581    CDS       T00773                                 

Gene name
glcK
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cpo  Coprothermobacter proteolyticus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    COPRO5265_0581 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COPRO5265_0581 (glcK)
   00052 Galactose metabolism
    COPRO5265_0581 (glcK)
   00500 Starch and sucrose metabolism
    COPRO5265_0581 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    COPRO5265_0581 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    COPRO5265_0581 (glcK)
   00524 Butirosin and neomycin biosynthesis
    COPRO5265_0581 (glcK)
Enzymes [BR:cpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     COPRO5265_0581 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(523352..524221)
Genome map
AA seq 289 aa AA seqDB search
MEILAIDVGGTKVDMGIVKDGKLIARDRFLNSPSENIVNLISSYIKDKDIDGVGIGVAGQ
VDYETGTVIFGGNIGWENFPLGRLLQEELNVPVFVENDANIFALGVWKYELGSKPESVLG
VTLGTGIGGGFVYEGDLLRSKRGATLEIGHMVIEAEGPACTCGSHGCLESLAGGWALEKW
YSERTGEKLTGAQIHERARSGDKEAIFLYQRLGYYLGIACASLANILNPDIIVLGGSISA
TFPLWQDIYEAEIRRRAVPPVKDTPTVVSTLKEAALLGASALVEQALTR
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggagattttggcaatagatgtgggtgggacaaaagtggacatgggtattgtcaaagac
ggaaaactcattgccagggatcgttttcttaacagccccagtgaaaacattgtcaatttg
atttcatcctatatcaaagataaagatattgacggagtgggcattggcgtagcaggacag
gtggattacgaaactgggaccgtcatatttggcgggaatattggctgggagaactttcca
ttgggaaggctcttgcaggaggaattgaatgtgcccgtgttcgtggaaaacgatgccaac
atttttgctttgggggtctggaagtacgaactaggtagcaaacctgaatccgttcttggt
gttacattgggtactggcattggtggaggttttgtttacgaaggcgatttgctccgctca
aaaagaggcgccactttagaaatcggacacatggtcatagaagcagaaggtccagcgtgc
acgtgtggttcccatggctgcttggagtcattggcaggcggttgggctttagaaaaatgg
tacagcgaacgcacaggagaaaagcttacaggtgcacaaatccatgaaagagcacgcagt
ggagacaaagaggcaatctttctttatcaaagactgggttattacctgggcatcgcttgt
gcatcattggcaaacattttgaaccccgatattatcgttctagggggtagcatcagcgca
accttccccttatggcaagacatatatgaggcagagatccgcagacgcgcagtgccaccc
gtaaaagacacgccaaccgtggttagtacgctgaaagaggcggcattgctaggcgcatct
gcattagtggaacaagctcttactcgatga

DBGET integrated database retrieval system