KEGG   Coprothermobacter proteolyticus: COPRO5265_0719Help
Entry
COPRO5265_0719    CDS       T00773                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
cpo  Coprothermobacter proteolyticus
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cpo00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cpo00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
654732..656009
Genome map
AA seq 425 aa AA seqDB search
MSVLIIDGGIPLKGKVTAQGCKNSALAILAAAALCEDRVYLTNVPDIGDVKTMMSILRSL
GYKVTWGSGLTIKPGVIKNYDLTHTGAGSIRGSLLFLGALLGRLGKVVLPMPGGCNIGTR
PIDLHLKGLSLMGASLDIQGGNIVGEAPSGLKGAYVYLDFPSVGATENIMIAGALASGET
TIENAAQDQQVVELGKFLMACGVKIHGLGTKVIRIKGKKEIGGVTFRISGDSIEAGTYAI
AAAATRGSITVDGVDVTFLRPLLFKLQEAGIEVVVTNGHEVTVLPSPRPKGITIKTMPFP
GFPTDLQPLMMSLLATAEGRSVITETVYDGRMGHVSELWKMGANIEVEGNTAIITGVEKL
TGAPVVANNLRAGAALVVAGLSAEGRSVVYGMEHVMRGYSNIHQKLRALDAKVELVSDEE
AVNIA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttttaattatagacggtggaattcccttaaagggaaaggtaacggctcaaggt
tgtaagaacagtgcattagccattctagctgcagcggccctgtgcgaagatagggtgtat
ttgacaaatgttccggacattggcgatgtgaaaacaatgatgtctattctaagatctttg
ggatacaaagtaacgtggggcagtggccttaccataaaaccaggtgttattaagaattat
gaccttacccacacgggagcagggtccataagagggtctctgcttttcttaggagcatta
cttggccgcctggggaaagtggtcctccctatgccgggaggctgcaacattggaacaagg
ccaattgaccttcatttgaaaggtctcagcctgatgggtgcaagtctggatattcaaggt
ggaaacattgtaggagaagctcccagtgggctgaaaggagcatatgtttacctggatttc
cccagtgtgggcgctaccgagaatatcatgattgctggtgctttagccagtggagaaacc
acaattgagaacgcagctcaggatcagcaagttgttgagctaggtaagtttttaatggct
tgtggcgtgaaaatccatgggcttggaaccaaggttatacgtattaaagggaagaaagag
ataggtggcgtcacctttagaatatcaggagacagcattgaagctggtacttatgccata
gcagctgcggcgacaagaggttccataacagtggatggcgtagacgttacgtttctcagg
ccactacttttcaaactgcaagaagcaggcatagaagtagtcgtaacaaatggccatgag
gtcacggtactgcccagccctcgtcccaagggaataacgattaagactatgccttttccg
ggtttccccactgatttgcaacctctaatgatgtcacttctggccacagctgaaggtaga
tcagtaattacagaaactgtgtacgatggaagaatggggcatgtcagtgaactttggaaa
atgggagcaaacatcgaagtagaaggcaataccgccatcattactggcgtggaaaaactt
actggtgcacctgttgttgctaacaatcttagggcaggtgcggctttggtggtagcaggc
ttgtctgcggaaggtagaagcgttgtttacggcatggagcacgtaatgcgtggttattcc
aacattcatcaaaaactaagagctttagatgccaaagttgaactcgtaagcgatgaagaa
gcagtcaatattgcttga

DBGET integrated database retrieval system