KEGG   Coprothermobacter proteolyticus: COPRO5265_0730Help
Entry
COPRO5265_0730    CDS       T00773                                 

Gene name
tpiA
Definition
(RefSeq) triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cpo  Coprothermobacter proteolyticus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    COPRO5265_0730 (tpiA)
   01230 Biosynthesis of amino acids
    COPRO5265_0730 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COPRO5265_0730 (tpiA)
   00051 Fructose and mannose metabolism
    COPRO5265_0730 (tpiA)
   00562 Inositol phosphate metabolism
    COPRO5265_0730 (tpiA)
Enzymes [BR:cpo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     COPRO5265_0730 (tpiA)
Exosome [BR:cpo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   COPRO5265_0730 (tpiA)
  Exosomal proteins of bladder cancer cells
   COPRO5265_0730 (tpiA)
  Exosomal proteins of melanoma cells
   COPRO5265_0730 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
664356..665075
Genome map
AA seq 239 aa AA seqDB search
MRYVFGNWKMNGTLAFAEEYVNKLLGEVRPASVQVALFPPFTALSSFQYLVKDSFLKFGA
QNMYYEDSGAFTGEVSPVMLKEIGVDYVLIGHSERRHIFLENDEMLMKKVEAAHRHDIPV
VFCVGETLEERRTGATKDVLKRQLILVQDILSRGDIVAYEPVWAIGTGVTPTMDEIRESI
SWVKELLKADLPVLYGGSVNKGNAVDISEVSGVDGVLVGGASLKVEEFAIIIKAFDQNI
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
ttgagatacgtttttggcaactggaagatgaacggtaccttggcttttgccgaggagtac
gtaaacaaacttttgggagaagtgcggcctgcgtcagtgcaggtcgcactctttcctcct
tttactgctctaagcagttttcaatatcttgttaaagatagctttttgaaattcggtgct
caaaacatgtattacgaggattccggcgccttcacaggagaagtgtcacctgttatgtta
aaggagattggtgtggactatgtactcatcggtcactccgagaggcgtcacatttttctt
gagaatgatgagatgctaatgaagaaagttgaagcagctcacaggcatgatataccggta
gtgttttgcgtcggcgaaacacttgaggaaaggcgcactggagccactaaagatgttttg
aagcgtcaacttatcttggtacaggacattctaagcagaggagacattgttgcctatgag
cctgtatgggccataggaacgggcgtgaccccgaccatggacgaaattagggaaagtatc
tcctgggtgaaggaattattaaaagcagacttacctgttctttacgggggcagtgttaac
aaaggcaatgctgttgatatttccgaagtgtctggggtggatggagttttggtaggtgga
gctagcctaaaagttgaagaatttgctattataataaaagcgttcgaccagaatatttag

DBGET integrated database retrieval system