KEGG   Coprothermobacter proteolyticus: COPRO5265_0730Help
Entry
COPRO5265_0730    CDS       T00773                                 

Gene name
tpiA
Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cpo  Coprothermobacter proteolyticus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    COPRO5265_0730 (tpiA)
   01230 Biosynthesis of amino acids
    COPRO5265_0730 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COPRO5265_0730 (tpiA)
   00051 Fructose and mannose metabolism
    COPRO5265_0730 (tpiA)
   00562 Inositol phosphate metabolism
    COPRO5265_0730 (tpiA)
Enzymes [BR:cpo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     COPRO5265_0730 (tpiA)
Exosome [BR:cpo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   COPRO5265_0730 (tpiA)
  Exosomal proteins of bladder cancer cells
   COPRO5265_0730 (tpiA)
  Exosomal proteins of melanoma cells
   COPRO5265_0730 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
664356..665075
Genome map
AA seq 239 aa AA seqDB search
MRYVFGNWKMNGTLAFAEEYVNKLLGEVRPASVQVALFPPFTALSSFQYLVKDSFLKFGA
QNMYYEDSGAFTGEVSPVMLKEIGVDYVLIGHSERRHIFLENDEMLMKKVEAAHRHDIPV
VFCVGETLEERRTGATKDVLKRQLILVQDILSRGDIVAYEPVWAIGTGVTPTMDEIRESI
SWVKELLKADLPVLYGGSVNKGNAVDISEVSGVDGVLVGGASLKVEEFAIIIKAFDQNI
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
ttgagatacgtttttggcaactggaagatgaacggtaccttggcttttgccgaggagtac
gtaaacaaacttttgggagaagtgcggcctgcgtcagtgcaggtcgcactctttcctcct
tttactgctctaagcagttttcaatatcttgttaaagatagctttttgaaattcggtgct
caaaacatgtattacgaggattccggcgccttcacaggagaagtgtcacctgttatgtta
aaggagattggtgtggactatgtactcatcggtcactccgagaggcgtcacatttttctt
gagaatgatgagatgctaatgaagaaagttgaagcagctcacaggcatgatataccggta
gtgttttgcgtcggcgaaacacttgaggaaaggcgcactggagccactaaagatgttttg
aagcgtcaacttatcttggtacaggacattctaagcagaggagacattgttgcctatgag
cctgtatgggccataggaacgggcgtgaccccgaccatggacgaaattagggaaagtatc
tcctgggtgaaggaattattaaaagcagacttacctgttctttacgggggcagtgttaac
aaaggcaatgctgttgatatttccgaagtgtctggggtggatggagttttggtaggtgga
gctagcctaaaagttgaagaatttgctattataataaaagcgttcgaccagaatatttag

DBGET integrated database retrieval system