KEGG   Coprothermobacter proteolyticus: COPRO5265_0743Help
Entry
COPRO5265_0743    CDS       T00773                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cpo  Coprothermobacter proteolyticus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:cpo00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
674440..675525
Genome map
AA seq 361 aa AA seqDB search
MALKVAVIGATGSVGKQTLEVIDRFPDKFVPTLLVGGKNVELLQILGKKYGCSVFSPWLH
GPAELPLDKLESSDIMVYAASTVDYLNYMSHFLGLGKPVCLSTKEIIVEAWPLIESFSGL
IRPVDSEHSALWRIGAKEPGVKSIYVVGSGGSLRDRKREEIENATLDQVLSHPVWNMGPK
VTFDSAFLINKSMEVIEASHLFNLRGEQISIVIERTGSIHALVDFVDGSRNVFFSKPTML
IPIAYALSYPSILPLDEETVRQPGDALGYRLDKPDFDRFPWGKLGHYALELGYTSRMAFS
VADEIAFECFKDKIMKPSDIYDFLVKAIEDYRAISYPESITEYFSLRHDMIEKMWKEVRA
I
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggctttgaaagtagctgttattggagccacaggctctgttggcaagcaaacattggaa
gtaatcgataggtttcctgataagtttgtgccgaccttgctagtgggcggtaagaacgtc
gaacttttgcagattttgggaaagaaatatggttgttcagtcttcagtccatggcttcat
ggtcctgcagaattaccattggacaaattagagagttcagacattatggtctacgctgca
tctacggtggattatttaaactacatgagccatttcttgggcttggggaagcctgtgtgc
ctttcaacaaaagaaatcatagtagaggcttggccattaattgaaagctttagtggattg
ataagaccagtggattctgagcacagtgctctatggcgcataggggcaaaagaacctggt
gtcaagagcatttatgtagttggatcaggaggttcattacgtgacaggaagagggaagag
atagaaaacgcaaccttggatcaggtgctcagtcatcctgtgtggaatatgggacccaag
gtcacgttcgattctgcttttctcattaacaaatccatggaggttatcgaagcgtctcac
ctgttcaacttgaggggcgaacaaattagcattgtcatagaaaggactggatctattcat
gctttagtagacttcgtggatggctcacgaaacgtctttttttcaaagccgaccatgcta
atccctattgcttacgctttatcatacccaagtattctcccccttgatgaggagacagta
aggcagcccggcgatgcccttggttaccgactagataagcctgactttgacaggttccct
tggggcaagttaggccactatgctttagaacttgggtatacgtccaggatggcgttttct
gtggctgatgaaattgcttttgagtgtttcaaagacaagattatgaaaccttctgatata
tatgatttcttagtcaaagccatagaagattacagagcaatatcttaccccgagtctata
actgaatatttctcattacgccatgatatgattgaaaaaatgtggaaggaggttcgagct
atttga

DBGET integrated database retrieval system