KEGG   Coprothermobacter proteolyticus: COPRO5265_0860Help
Entry
COPRO5265_0860    CDS       T00773                                 

Definition
(GenBank) pyrophosphate--fructose-6-phosphate 1-phosphotransferase
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cpo  Coprothermobacter proteolyticus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cpo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COPRO5265_0860
   00030 Pentose phosphate pathway
    COPRO5265_0860
   00051 Fructose and mannose metabolism
    COPRO5265_0860
   00052 Galactose metabolism
    COPRO5265_0860
  Energy metabolism
   00680 Methane metabolism
    COPRO5265_0860
Enzymes [BR:cpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     COPRO5265_0860
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     COPRO5265_0860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
780892..781926
Genome map
AA seq 344 aa AA seqDB search
MDNIKRLGVLTGGGDAPGLNPAIRGVFYKAVELGYEVIGIKDGWKGLLEKETIVLSKADV
DSALTKGGTILGSSRTNPYKREGGKEIAYENFKELGLSGLIAIGGEDTLGVAGQLVRDYQ
LPINGVPKTIDFDVPETDFTLGFFTALEVTTDILERLQDTAKSHHRVMVLEVMGRHAGWL
GLFTAVAGGADYVLVPEKKADIEELIAKTKRALSDKGFAVVVVSEGAVLDESMLKDRPVD
EFGHVQLGGMGEVVAQFLEKSLNTEVKCVILGHAQRGGKPSVIDRILPQLQALKAVEWLD
KGQTGVLAAYKEGTIKPVDLTLVVGKNRPLPESLIDDFGVFFKG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
gtggataacataaagcgacttggcgttttaaccggtggaggcgacgcacctggactaaat
ccagctattcggggagttttctacaaagctgtggaattgggatatgaggtcataggtatt
aaggatggttggaaaggccttttagaaaaagaaaccatagtgctatccaaagctgatgta
gacagtgctcttacaaagggtggtactattctgggctcaagccgtaccaatccttacaaa
agagaaggcgggaaagaaattgcctatgaaaacttcaaagaacttgggctcagtggtctt
attgccataggtggcgaagataccttaggcgttgctgggcagcttgtcagagattaccaa
ctacccataaacggagtgccaaagacgattgattttgacgttcccgaaactgattttacg
ttaggtttctttacagctctggaagttaccacggacatacttgaaaggctgcaagacacc
gctaagagccaccatcgtgtcatggtattagaagttatgggacgtcacgcaggatggctg
ggtctttttactgccgtagctggcggcgccgattacgtgttagttcctgaaaagaaagct
gacatagaagagcttattgcgaagacaaaaagagctctctctgacaaagggttcgctgta
gtagtggtatcagagggggctgttttagacgaaagcatgctcaaagacagacctgttgat
gaatttggccatgttcaactgggtggcatgggagaagtggttgcgcagttcttagaaaaa
agcttgaatacggaagtgaaatgcgttattctaggccatgctcaaagaggtggtaaacct
tctgtgatagacagaatacttccacaacttcaagcgcttaaagcggtggaatggttagac
aagggacagactggtgtcttagctgcatacaaagaaggtaccattaagccggttgatctt
acactggttgtggggaaaaacaggcctcttcctgagtctttaatagacgattttggagtc
tttttcaaaggataa

DBGET integrated database retrieval system