KEGG   Coprothermobacter proteolyticus: COPRO5265_0860Help
Entry
COPRO5265_0860    CDS       T00773                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cpo  Coprothermobacter proteolyticus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    COPRO5265_0860
   01230 Biosynthesis of amino acids
    COPRO5265_0860
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COPRO5265_0860
   00030 Pentose phosphate pathway
    COPRO5265_0860
   00051 Fructose and mannose metabolism
    COPRO5265_0860
   00052 Galactose metabolism
    COPRO5265_0860
  Energy metabolism
   00680 Methane metabolism
    COPRO5265_0860
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    COPRO5265_0860
Enzymes [BR:cpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     COPRO5265_0860
Protein phosphatases and associated proteins [BR:cpo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     COPRO5265_0860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
780892..781926
Genome map
AA seq 344 aa AA seqDB search
MDNIKRLGVLTGGGDAPGLNPAIRGVFYKAVELGYEVIGIKDGWKGLLEKETIVLSKADV
DSALTKGGTILGSSRTNPYKREGGKEIAYENFKELGLSGLIAIGGEDTLGVAGQLVRDYQ
LPINGVPKTIDFDVPETDFTLGFFTALEVTTDILERLQDTAKSHHRVMVLEVMGRHAGWL
GLFTAVAGGADYVLVPEKKADIEELIAKTKRALSDKGFAVVVVSEGAVLDESMLKDRPVD
EFGHVQLGGMGEVVAQFLEKSLNTEVKCVILGHAQRGGKPSVIDRILPQLQALKAVEWLD
KGQTGVLAAYKEGTIKPVDLTLVVGKNRPLPESLIDDFGVFFKG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
gtggataacataaagcgacttggcgttttaaccggtggaggcgacgcacctggactaaat
ccagctattcggggagttttctacaaagctgtggaattgggatatgaggtcataggtatt
aaggatggttggaaaggccttttagaaaaagaaaccatagtgctatccaaagctgatgta
gacagtgctcttacaaagggtggtactattctgggctcaagccgtaccaatccttacaaa
agagaaggcgggaaagaaattgcctatgaaaacttcaaagaacttgggctcagtggtctt
attgccataggtggcgaagataccttaggcgttgctgggcagcttgtcagagattaccaa
ctacccataaacggagtgccaaagacgattgattttgacgttcccgaaactgattttacg
ttaggtttctttacagctctggaagttaccacggacatacttgaaaggctgcaagacacc
gctaagagccaccatcgtgtcatggtattagaagttatgggacgtcacgcaggatggctg
ggtctttttactgccgtagctggcggcgccgattacgtgttagttcctgaaaagaaagct
gacatagaagagcttattgcgaagacaaaaagagctctctctgacaaagggttcgctgta
gtagtggtatcagagggggctgttttagacgaaagcatgctcaaagacagacctgttgat
gaatttggccatgttcaactgggtggcatgggagaagtggttgcgcagttcttagaaaaa
agcttgaatacggaagtgaaatgcgttattctaggccatgctcaaagaggtggtaaacct
tctgtgatagacagaatacttccacaacttcaagcgcttaaagcggtggaatggttagac
aagggacagactggtgtcttagctgcatacaaagaaggtaccattaagccggttgatctt
acactggttgtggggaaaaacaggcctcttcctgagtctttaatagacgattttggagtc
tttttcaaaggataa

DBGET integrated database retrieval system