KEGG   Coprothermobacter proteolyticus: COPRO5265_0862Help
Entry
COPRO5265_0862    CDS       T00773                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cpo  Coprothermobacter proteolyticus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    COPRO5265_0862
   01230 Biosynthesis of amino acids
    COPRO5265_0862
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COPRO5265_0862
   00030 Pentose phosphate pathway
    COPRO5265_0862
   00051 Fructose and mannose metabolism
    COPRO5265_0862
   00052 Galactose metabolism
    COPRO5265_0862
  Energy metabolism
   00680 Methane metabolism
    COPRO5265_0862
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    COPRO5265_0862
Enzymes [BR:cpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     COPRO5265_0862
Protein phosphatases and associated proteins [BR:cpo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     COPRO5265_0862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
781930..782880
Genome map
AA seq 316 aa AA seqDB search
MKRIGILTSGGDSPGMNAAICGAVIAAEQRNIEVIGVRNGFDGLLEEQFLPLSSSRVRGI
NSLGGTILGTSRSDRFLLPEWRRRVPDTLSSTGIDGLIVIGGNGSLRGAMALEEAGIPTV
GIPGTIDNDLGGTDFTLGFITAAETAVKAVRRLTDVALSERGIFFVEVMGRNSGYIAMFV
GLATGADFVNIPEAPATSEEIYTKISQAEGSAIVIWAEGCGDPSPLAEWLREELNRDIEI
SRIGHLQRGGTPATLDSFLGFTMGAAALYTISEGRHSIMIGTRNLQPVEVPYEVAIEPNP
LPPYLQSMLLPLLNSR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaatcggcatactaacgtccgggggtgattcccccggaatgaatgcagctatt
tgtggagctgtcatagccgccgaacagagaaatattgaagtcataggtgtgcgcaatggt
tttgatgggcttctggaggagcaatttttgcccttaagttccagccgagtcagaggaata
aactctctcggcgggactattcttgggacgtctcggagtgatagattcctgcttcctgaa
tggagacggcgagtgccagatacgctttcctctactggcatcgacgggctcatagtaatt
gggggaaatgggtccttgcgaggtgcaatggctttagaggaagcaggcatccccactgtg
ggaatcccagggactattgataatgatttgggaggcactgacttcacactgggattcata
acagccgctgaaacagcggtaaaagcagttcgtcggctaactgatgtggcgttgtctgaa
aggggaattttctttgttgaagttatgggacgaaattctggttatatagccatgtttgta
ggtctggcaaccggagctgattttgtcaatataccggaagccccagcaacatctgaggaa
atctatacaaagataagccaagccgaaggtagtgccatcgtcatatgggctgaaggctgc
ggagatccatcaccgcttgcggagtggctaagagaagaattgaatagagacatagagatt
tctcgcattggtcatttgcagaggggtggtactccggcaaccttagattctttcctaggt
tttaccatgggagcagctgcgctttataccatatctgaaggacgccactctattatgata
gggactagaaatctacagcctgttgaagtaccttatgaagtggcaattgagccaaaccca
cttcctccctaccttcagtccatgctactaccgcttttaaactcacgttga

DBGET integrated database retrieval system