KEGG   Coprothermobacter proteolyticus: COPRO5265_0903Help
Entry
COPRO5265_0903    CDS       T00773                                 

Definition
holliday junction ATP-dependent DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cpo  Coprothermobacter proteolyticus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    COPRO5265_0903
Enzymes [BR:cpo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     COPRO5265_0903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(817463..818011)
Genome map
AA seq 182 aa AA seqDB search
MLLKVSGTLSQEDESYWFSLKTGLSIEVTRCTTRAGDGEYLFFVSFDNDIRVFVFSNKEE
FGLFQVLKNVKGVGNIKASRILSLYDVQQLLNMIKAGDEHELALLPGIGERTAKRIVAEL
SGRLTHTRHDFDNDFMEVVNAACDLGYERNVVTELLNGSSEWRDKTLEDALRWVIRELNK
KA
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
gtgctgttgaaagttagtggaacacttagtcaggaagacgagtcttattggttttctttg
aaaacgggtttgtccatcgaagtaaccagatgtaccactagggccggagatggcgaatac
ttgttttttgtttcttttgacaatgatatacgcgtttttgttttttctaacaaggaagaa
tttggtctttttcaggtacttaagaatgtgaagggcgtcggaaacattaaagcttctcga
atactttcgttgtatgatgtacagcaacttctaaacatgatcaaagctggcgatgagcat
gagctggcactactgcctggtataggagaacgaacggccaaaagaatagtggcggaactt
agtggtcgtttgacacatacccgccacgacttcgacaatgattttatggaagtggtaaat
gcagcttgcgacttgggctatgaacgtaatgtggtaacagagctcttaaatggtagtagt
gaatggcgagataaaacattggaagatgcattaagatgggtaataagggaactcaacaag
aaggcgtaa

DBGET integrated database retrieval system