KEGG   Coprothermobacter proteolyticus: COPRO5265_1137Help
Entry
COPRO5265_1137    CDS       T00773                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cpo  Coprothermobacter proteolyticus
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cpo00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    COPRO5265_1137
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    COPRO5265_1137
Enzymes [BR:cpo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     COPRO5265_1137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1012257..1013558
Genome map
AA seq 433 aa AA seqDB search
MESMAAGHSSTGNENSGTQLINFSSDDRWFMDGDIFFAFTGAHFDARTLIPELKNKAKLI
ITEKEATGSNVIYRPDARQIYKKFIKAGAKVYPLHVLGITGTKGKSTIAWWLSSLLGFGY
MGTLGIRAKDVKFVLPTTTTGADALFNTYRRTGEDHWVVELSSIGLAEDRLPLPLEGLVW
TTFEPEHMDYHKTTYAYFLAKKKAFSYLKKGTFALLGQNVPQADIGTPYLTLRYGDTGNF
YILDRREYEWEQEVKIYTPQGPSVVHIPMPGKVFAHDAVGTVAAAFLWKGTKLEGEFPSV
PVRMNHVIINGIEMVIDFAHTPESIDACLQTVAQRWGNDFVVIHGATGYEPQNKSYEIIK
VINRYGIPGAASIIKSLDQRQSEETLRRYENAGFITGSSTEVFQLCSKKFKKWVIVGMRD
AYDRLKEAGIYGT
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggagtctatggcagcggggcattcatctaccggcaatgaaaacagcggcacacaattg
ataaatttctcatcagacgaccgctggttcatggatggagatattttctttgcttttacc
ggcgcacactttgatgctcgcaccctcataccagagcttaaaaacaaggcaaaactcatc
ataacggagaaagaagccacaggatctaacgtcatatatcgtcctgatgctcgtcaaatc
tacaagaaattcataaaggcaggagcaaaagtttatcctttgcatgttcttggcattaca
ggtaccaaaggtaagagcaccattgcatggtggttatcctctttgctgggatttggctat
atgggaacacttggcataagagctaaggatgttaaatttgtcttgcctaccacgactacg
ggtgctgatgctttgtttaacacttatcgaaggactggagaagatcactgggtagtggaa
ctctcttccattggtttggcagaagacaggcttccactgccgctggagggtctagtatgg
accacatttgaaccagaacacatggactatcacaaaaccacatacgcatacttcttggct
aagaaaaaagccttttcttacctaaaaaaaggtactttcgcgttactaggacaaaacgtg
ccacaagctgacattggtacaccttacttaactctgaggtatggtgatactggcaacttc
tacattttggacagaagagaatacgaatgggaacaagaagtgaaaatttacacacctcaa
ggaccctctgtggtacatatccccatgcctgggaaagtttttgctcacgacgctgtgggc
accgtggcagcggcttttctttggaaaggtactaaactagaaggtgaatttccttccgtt
ccggttcgtatgaaccacgtcatcataaatggtatcgaaatggtcatagattttgctcac
acgccagagagcatagatgcatgtttgcaaacagttgcccagcgctggggtaatgatttt
gtggtcatacacggagctaccggttacgaaccgcaaaacaagagctacgaaatcataaaa
gttataaaccggtatggcatcccaggagcagcttccatcataaagtcccttgaccagcgc
caatctgaagaaacgctgagaaggtatgaaaacgctggtttcataacaggaagtagcacc
gaagtatttcagctctgcagtaagaagttcaagaaatgggtcatcgtgggaatgagagat
gcctacgacaggctaaaggaggctggtatttatggaacttga

DBGET integrated database retrieval system