KEGG   Coprothermobacter proteolyticus: COPRO5265_1185Help
Entry
COPRO5265_1185    CDS       T00773                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cpo  Coprothermobacter proteolyticus
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cpo00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1058644..1059309)
Genome map
AA seq 221 aa AA seqDB search
MGGRLIVISGPSGVGKGTVVSELLNRDKELVLSISVTTRSPRPGEVDGKDYYFVDYSTFK
KMVATDRLLEWAYVHGSYYGTPKDFVMQHLEQGRKVILEIDMQGAMQVRRRFPDAILIFL
LPPSLDELKHRLMKRGTEEMDEQQLRLLRSLQELDYLREYHFFVVNVEVNQAVENIMKIL
SLVDFVVTEDRARTMVESLRKGGIFDEAGDIRRAGENYWTP
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
gtgggcggtagactcatcgtcatcagtggcccttccggtgtagggaagggaaccgtggta
agcgagcttctaaacagagataaagaacttgtgctctctatttctgtgaccactcgcagc
cctaggcctggtgaggttgacggcaaagattattattttgtcgattactccacattcaag
aagatggttgccacggatagattgctcgagtgggcctatgttcatggttcctactatgga
actcctaaagactttgtgatgcagcacttggagcaaggcagaaaggtgatcttggaaatt
gacatgcagggagccatgcaagttcgaaggaggttcccagatgctattctgatatttctg
ttgcctccttctttggacgagcttaagcatcgtttgatgaagcgcggcactgaagagatg
gacgagcagcagcttaggctgcttcgtagcttacaagagcttgattacctcagggaatac
cattttttcgtggtcaatgtggaggtaaatcaagccgtggaaaacataatgaagattctg
tccttggtggacttcgtagttactgaggacagggcacgcaccatggtggaatctctaaga
aaaggaggtatttttgatgaagcaggtgacattagaagagctggagagaattactggact
ccctag

DBGET integrated database retrieval system