KEGG   Coprothermobacter proteolyticus: COPRO5265_1196Help
Entry
COPRO5265_1196    CDS       T00773                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
cpo  Coprothermobacter proteolyticus
Pathway
cpo00010  Glycolysis / Gluconeogenesis
cpo00020  Citrate cycle (TCA cycle)
cpo00620  Pyruvate metabolism
cpo00640  Propanoate metabolism
cpo00650  Butanoate metabolism
cpo00680  Methane metabolism
cpo01100  Metabolic pathways
cpo01120  Microbial metabolism in diverse environments
cpo01130  Biosynthesis of antibiotics
cpo01200  Carbon metabolism
Module
cpo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cpo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COPRO5265_1196
   00020 Citrate cycle (TCA cycle)
    COPRO5265_1196
   00620 Pyruvate metabolism
    COPRO5265_1196
   00640 Propanoate metabolism
    COPRO5265_1196
   00650 Butanoate metabolism
    COPRO5265_1196
  Energy metabolism
   00680 Methane metabolism
    COPRO5265_1196
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    COPRO5265_1196
Enzymes [BR:cpo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     COPRO5265_1196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ACI17704
UniProt: B5Y9Q7
Position
complement(1068094..1069041)
Genome map
AA seq 315 aa AA seqDB search
MAVINIKNLTDLEPRFVGGHRLCAGCNEGTIVRQVLLAAHEYEVVVLNATGCLEVTTSVY
PYTSWNVPWLHEAFENVAAAASGAEAAYKALKRFGEIPEDKQIKFIAFAGDGGTYDIGLQ
ALSGALERGHSFLYVLLDNEAYMNTGIQRSSSTPKFAWTTTSPVGEVSPGKTQPKKNIVE
IVAAHGVPYVATASPSHYVDLMTKVQKALSYDGPTFLAVYSNCNRGHRNDTALSIKVARM
AVETNYWPLYEIEEGKYRITYRPRKPQPIEEWLKLQGRFSHLMKPGNQDRVKELQDWVNS
KWELLQKKEEFSKTL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgataaatataaagaacctcactgatttggagccgcgtttcgtaggtggccat
cgtctgtgcgctggctgcaatgagggaaccattgttcgtcaggttttgctagcggcacac
gaatacgaagtggttgtattaaatgctactggttgtttggaagtaaccacttcggtttat
ccttacacctcgtggaacgtgccttggcttcacgaagcttttgagaatgtagctgcggca
gccagtggtgcagaggctgcttacaaagcgctgaaacgttttggggaaattcctgaagat
aagcagataaagttcattgcttttgctggtgacggagggacctacgatattggtcttcaa
gctttgtcaggcgctttggaaagaggtcacagcttcctttatgtacttctagataacgaa
gcctacatgaacacaggaattcagagatcttcttcaacacccaagtttgcttggacaacc
acatctcccgtgggtgaggtaagtcctggaaaaacgcagcctaagaagaacattgtggaa
attgttgctgctcatggtgtaccttatgtggccactgcatctccaagccactacgtggat
ttaatgaccaaggttcagaaagctctaagttatgatggtcccacgttcttggctgtgtac
tctaactgcaacaggggacacagaaatgacacggctctttccataaaggtagctagaatg
gctgtggaaacaaactattggccactgtatgagattgaagagggcaaatacagaataacc
tacaggcctcgtaagccccagcccatcgaggaatggctaaagcttcagggacgtttctcg
catctgatgaaacctggaaatcaagacagagttaaagaacttcaagattgggttaatagc
aagtgggaactgttacaaaagaaagaagagtttagtaagactttgtag

DBGET integrated database retrieval system